KEGG   Natrialba magadii: Nmag_0638Help
Entry
Nmag_0638         CDS       T01176                                 

Definition
(GenBank) transcriptional regulator, TrmB
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrmB HTH_24 GntR Glyco_hydro_36 TFIIE_alpha HTH_9 HTH_20 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ADD04223
UniProt: D3SZ89
Position
complement(631235..632113)
Genome map
AA seq 292 aa AA seqDB search
MDPDDTTERQVDDTTDDSRPTAQSNAETDADGRSVPDSTAVDANAGSERNRRTDGPNEAT
EPGEASETTENDDTSDGMRTAAAEEVDQRIVDLLSWILDTETRAKIYVHLLAHPASTSEE
VAKGTGLYPSTVREALAELHDEERVTRQKRASEGAGNNPYEYTAIQPSDLVGGVVDQVQQ
ELNTIFTLDRVLDRSADGNTDGSQTHGFDPVTITVDSDDTDIDTDAGEDTITGTESNTST
ETDPDSSTTANTGTGTNTNTNTTVDDPAADADSTPDTDTTTSSSEATDTHDR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacgatacaaccgagcgacaggtggatgacaccacggacgacagccggccg
actgcccagtctaacgctgagacggacgcagacggccggagcgttcccgattcgacagcg
gttgacgccaacgctgggagtgagcgcaaccgtcgcactgacggccccaacgaggcgacc
gaaccgggtgaggcgagtgagacaaccgagaacgacgacaccagcgacggcatgcgaaca
gccgccgccgaagaagtcgaccagcgtatcgtcgacctgctctcgtggatcctcgacacc
gaaacccgcgcgaaaatctacgtccacctgctcgcccaccccgcgagcacctcagaggag
gtcgcgaagggaaccggtctctacccgagtaccgtccgcgaagcgctcgccgaactccac
gacgaagagcgcgtcacacgccagaaacgtgctagcgaaggcgcaggaaacaacccctac
gagtacaccgcgatccagccaagcgacctcgtcggcggcgtcgtcgaccaggtccagcag
gagctaaacaccatcttcaccctcgaccgcgtgctcgatcgctcggcagacggaaacacc
gacggttcccagacgcacggcttcgacccggtgacgatcacggtcgatagcgacgatacc
gacatcgacactgacgcaggcgaggacacgattacgggaacagaatcgaacacaagcaca
gagacggacccggactcgagtaccaccgcaaacacgggcacgggcacgaacacgaatacg
aatacgaccgtcgacgacccagcagccgacgcggattccacccctgacaccgacactacc
actagctcgtccgaggcgaccgacacccacgacagatag

DBGET integrated database retrieval system