KEGG   Natrialba magadii: Nmag_0640Help
Entry
Nmag_0640         CDS       T01176                                 

Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing)
  KO
K03166  
DNA topoisomerase VI subunit A [EC:5.99.1.3]
Organism
nmg  Natrialba magadii
Brite
Enzymes [BR:nmg01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     Nmag_0640
DNA replication proteins [BR:nmg03032]
 Prokaryotic Type
  DNA Topoisomerases
   Nmag_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
634782..635870
Genome map
AA seq 362 aa AA seqDB search
MSADNEQAREQLIDLAAQFYDQFELGEIPHMSVPTRTKNNIEYDEDKDVWVYGDRESTRS
ANSVRGARKLLKAVYTIEFLADQLEEDRSSTLRELYYLSESWDNKEAQFNDQDESNGLIE
DLEIVSGVTREDFHMRPEESGATLMGPLHLREQTRRGEREIHCQEDVGEGGYQIPNNPDT
IEFLGTDADFILAVETGGMRDRLVENGFDEEYNALIVHLKGQPARATRRITKRLHDELDL
PVTVFADGDPWSYRIYGSVAYGSIKSAHLSEYLATPEAKYIGIQPADIVEYDLPTDPLSD
SDINALESELEDPRFQTEYWEEQIELQLEIEKKSEQQSLASHGLDFVTDTYLPERLDAMG
II
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagacaacgagcaagccagagagcagttgatcgatctcgcggcacagttctac
gaccagttcgaactgggcgagatcccccacatgtccgtcccaacgcggacgaagaacaac
atcgagtacgacgaggacaaggatgtctgggtctatggcgaccgtgaatcgacccgctcg
gccaactctgttcgcggcgcgcgcaaactgttgaaagccgtctacaccatcgagttcctc
gcggaccagttagaagaggatcgctcgtcgaccctgcgtgaactctactacctctccgaa
agctgggacaacaaggaggcccagttcaacgatcaggacgagtctaacgggctgatcgag
gacctggaaatcgtctccggcgtcacccgtgaggacttccacatgcgcccggaggaatcc
ggtgcaaccctcatgggcccgctgcacctgcgcgagcagacccgccgcggtgagcgcgag
atccactgccaggaagacgttggcgagggtgggtaccagattccgaacaacccagacacg
atcgagttcctgggcactgacgcagacttcatcctcgcagtggagactggtggtatgcgt
gaccgcctcgtcgagaacggcttcgacgaagagtacaacgcgctgatcgttcacctgaag
ggccagcccgcccgggcgacgcgccggattacgaagcgcctgcacgacgaactcgacctg
ccggtcacggtcttcgctgacggtgacccgtggtcgtaccggatctacggctcggtcgcc
tacggttcgatcaagtcggcacacctctcggagtacctcgcgacgcccgaggccaagtac
atcggcatccagcctgccgacatcgtcgagtacgatctgccgaccgacccgctgtcggat
tcggacatcaacgcgctggagagtgaactcgaggatccgcgcttccagacggagtactgg
gaggagcagatcgagttgcagttagagatcgagaagaagtccgaacagcagtcgctcgcg
tcccacggtctggacttcgtgacggatacgtatctgccggagcgcctcgatgcgatgggg
attatctaa

DBGET integrated database retrieval system