KEGG   Natrialba magadii: Nmag_0642Help
Entry
Nmag_0642         CDS       T01176                                 

Definition
(GenBank) putative signal transduction protein with CBS domains
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
636688..637110
Genome map
AA seq 140 aa AA seqDB search
MPIESLARSDVVTAHEDESVQELATRMDESHVGSVVITDGDEPIGIVTDRDLATRVLGDG
MDPAETTASDVMSDNITTVDQTAGFYEATELMSEHGIRRLPVCDDSNELVGIITADDLNE
LLADEHLQLSDVIQAQRPEY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgaaagccttgccagaagcgatgtcgtaacggcacacgaagatgagtccgtt
caggaactcgcaacacgcatggatgagtcccacgtcggcagtgttgtgatcactgacggt
gacgaaccgatcgggatcgttaccgaccgcgacctcgcaacgcgcgtactcggcgacggg
atggatcccgcagaaacgacagctagtgatgttatgtccgacaatatcacaactgtcgat
cagacggccggattctacgaggcaaccgaactgatgagtgagcatggtatccgtcggctc
cctgtttgtgacgatagtaacgaactggtcggaatcatcactgctgatgacctcaacgaa
ctcctcgccgacgagcacctgcagctttcggatgtcattcaggcccaacggccggagtac
tga

DBGET integrated database retrieval system