KEGG   Natrialba magadii: Nmag_0645Help
Entry
Nmag_0645         CDS       T01176                                 

Definition
(GenBank) hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
638306..638446
Genome map
AA seq 46 aa AA seqDB search
MATKESSESETPFDEVMEDIRGELVRRVAAADRDANRDIYDALENE
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaggaaagttcagagtccgaaaccccattcgatgaagtgatggaggatatc
cggggtgaactcgtccgtcgggtagcagcagctgaccgggacgcaaatcgagacatctac
gacgcactcgaaaacgagtaa

DBGET integrated database retrieval system