KEGG   Natrialba magadii: Nmag_0650Help
Entry
Nmag_0650         CDS       T01176                                 

Definition
(GenBank) hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HCV_NS4b
Motif
Other DBs
NCBI-ProteinID: ADD04235
UniProt: D3SZA1
Position
642350..642862
Genome map
AA seq 170 aa AA seqDB search
MGRLYRVVPVQTMSESMVTVALSGGALAVAVAVGLLAHEWMHALVLRVARIDYRLTYFPG
SATGFAGILAGRPWAVVRPQPRGHEPAWILRVAALAPLSLAVPVFAVGAGFVSPVAVPVD
INTTVATAFAIGWLACAIPSPQDFSVAFYAHRALEPVADSPSVGTHSRAD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtctctaccgggtggttcccgtccaaacgatgagtgaaagtatggtgactgtg
gccctgagtggtggggcgctggcggttgcggtcgctgttggcctgctggcacacgagtgg
atgcacgcactcgtcctccgcgttgcgcgaatcgactacagactcacgtacttcccgggg
agcgctacgggattcgcaggcatactcgccgggcgtccgtgggcggtcgtgcgtccacaa
ccacgcgggcacgaacccgcgtggatacttcgggtcgcggcgctcgcaccgctttcgctt
gcagtccccgtcttcgccgttggtgccgggttcgtctcgcccgttgcagttcccgttgac
atcaacacgacggtcgcgacagcgttcgcgatcggctggctcgcctgtgcgattccgagt
ccacaggatttttcggtcgcgttctacgcgcatcgcgcactcgagccggtagccgactcc
ccgtcggtgggtactcattcccgcgctgattga

DBGET integrated database retrieval system