KEGG   Natrialba magadii: Nmag_0658Help
Entry
Nmag_0658         CDS       T01176                                 

Definition
(GenBank) GrpE protein
  KO
K03687  molecular chaperone GrpE
Organism
nmg  Natrialba magadii
Brite
Chaperones and folding catalysts [BR:nmg03110]
 Heat shock proteins
  HSP24
   Nmag_0658
Mitochondrial biogenesis [BR:nmg03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    Nmag_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpE Exonuc_VII_L Spc7 SOG2 Reo_sigmaC Atg14 Med9 Filament MAD Fib_alpha HIP1_clath_bdg DUF1664 Bacillus_HBL ADIP ZapB GAS BST2 MPS2 TMPIT Noelin-1 Sipho_Gp157 FliJ NPV_P10 RPW8 AAA_13 DUF16
Motif
Other DBs
NCBI-ProteinID: ADD04243
UniProt: D3SZA9
Position
complement(653231..654463)
Genome map
AA seq 410 aa AA seqDB search
MSDDEGTNTPAQGVPSEDESAETAADDDVASAVAEAEAEAEADTESAATAAEADSDSEAA
PDSESEPEPDEEPDTPADESEPSDSAVDSETGAADSDPDTATPQDTDAADAADSGAETRG
AEPEQEQEPESESESETDSAPASEAESEPTPDTDSDQDPPSDAQQLVDRLAEYDEDLAQT
IDTVVSQARELSSTVEHQRAELEDLTERVEAQAETIGDLQNELDAREEELATKEEEVEDL
KSRLKRKQADFQNYKKRAKKRQDQIKDRATEDLVERLIGVRDNLKRALEEGSDDVDGLRD
GVEMTLREFDRILEDENVTEIDPDPGKETDPQRHEVMMQVDSEQPEGTIADVYTPGYEMG
EKVIQNAQVTVSNGELATDEDDAAEAEAEADSAGDADADSSDDVASDQSA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgacgagggcacgaacacacctgcccagggtgtcccgtctgaggacgagtct
gccgagacggcagctgacgacgatgttgcgtcagccgtcgcggaagcggaagctgaagct
gaagccgacactgagtcggcagcgacagcggcggaggcggactcagactcggaagcagcg
ccggactcggagtcggaaccggagccagacgaggaaccggacacaccggccgatgaatcc
gagccgtcggattcggccgtggattcggagacaggagctgccgactcggatccagacaca
gcgacgccacaggacacagacgcggcggacgcagccgattcaggggcagagaccaggggc
gcagaaccagaacaagagcaagaaccagagtcagagtcagaatcagagacggattctgcg
ccagcgtccgaagcagagtctgaacccacaccagataccgactcagatcaggacccacct
tccgacgcccagcaactcgtcgaccgcctcgccgaatacgacgaggacctcgcacagacc
atcgacaccgtcgtcagccaggcgcgggagctctcgagtaccgtcgaacaccagcgcgct
gaactcgaggacctgaccgagcgcgtcgaggcccaggccgagacgatcggtgatctgcag
aacgaactcgacgcgcgcgaggaggaactcgcgacgaaagaggaggaagtcgaggacctc
aagagtcgtctcaagcgcaagcaagcggacttccagaactacaagaaacgcgcgaaaaag
cgccaggatcagatcaaagaccgcgcgacggaggacctcgtcgagcgcctcatcggcgtc
cgtgacaacctgaagcgagcgctggaggagggcagcgacgatgttgacggcctccgtgac
ggcgtcgagatgacgctgcgcgagttcgaccgtattctcgaggacgagaacgtgaccgag
atcgatccggatccagggaaagaaacggatccgcagcgccacgaggtgatgatgcaggtc
gacagcgagcagccagagggaaccattgcggacgtctatacacccggctacgagatgggt
gagaaggtcatccagaacgcgcaggtgacggtctcgaacggcgagttggcgaccgacgag
gacgacgcagccgaagccgaagctgaagccgactctgcaggcgacgcagacgccgacagt
agtgacgacgtggcaagcgaccagtccgcgtag

DBGET integrated database retrieval system