KEGG   Natrialba magadii: Nmag_0667Help
Entry
Nmag_0667         CDS       T01176                                 

Definition
(GenBank) protein of unknown function DUF75
  KO
K06869  
uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
662163..662909
Genome map
AA seq 248 aa AA seqDB search
MARISLQGPEADLEDPTFVEGFPGIGLVGKIATDHLVDEFDMRYYASVHCQGLPRIGVYR
GGDRTARPPVRLYTSEEHDLLALQSDAPIRPEALDNVAECVTSWLIDHDATPLYLSGLPA
DRDTGERPDLYGVGTGSAPDLLDDREIDVPPEDGVVTGPTGALINHAAQAGYDSLGLVIE
CNPQFPDPEAASVLLEDAIAPLADLSVDVQELLDHAEEIREKREQLAQQMQAAGQEQSTQ
AQPLRMYQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaatcagtctgcagggaccggaagccgatctcgaggaccccacttttgtcgag
ggcttcccaggaatcggactcgtcggcaagattgcgactgaccatctcgtcgacgaattc
gatatgcgctactacgcgagcgtccactgccaggggctgcctcgaattggcgtctaccga
ggtggtgaccgaaccgctcggccacctgtccggctctataccagcgaggagcacgactta
ctcgcgctacagagcgacgcgccgatccgaccggaggcgctcgacaacgtcgccgagtgc
gtgacgagctggctcatcgaccacgatgcgacgccgctgtacctgagtgggctgccagcc
gatcgagacaccggcgagcggccagatctctacggcgtcggaacggggagcgcacccgat
ctcctcgacgatcgtgagatcgacgttccaccggaggacggcgtcgtcaccggtccgaca
ggcgcgctcatcaaccacgcggcacaggccggctacgacagcctcggactcgtcatcgag
tgcaacccgcagttccccgaccctgaagcggcgagcgtgcttctcgaggacgctatcgcg
ccgctggctgacctctcggtcgacgtacaggaactcctcgaccacgccgaggagatccgt
gagaaacgcgagcagcttgcacaacagatgcaggccgccggacaggaacagagcacgcag
gcacagccgcttcggatgtatcaataa

DBGET integrated database retrieval system