KEGG   Natrialba magadii: Nmag_0668Help
Entry
Nmag_0668         CDS       T01176                                 

Definition
(GenBank) geranylgeranyl reductase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_oxidored Trp_halogenase FAD_binding_2 DAO Pyr_redox_2 GIDA FAD_binding_3 HI0933_like Pyr_redox Thi4 Lycopene_cycl NAD_binding_8 AlaDh_PNT_C Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADD04253
UniProt: D3SZB9
Position
663054..664430
Genome map
AA seq 458 aa AA seqDB search
MTSATEAYDIVVVGGGTAGCFAATTAAKEGLDVVLLERKTEEEGGYIACGDGIKGKSSFP
DVLDRERLKDEAFTNQGIERAIFENPQTNERLDIPFNETGGVVDRWKYGQILLEETDRAG
VDIHYNTVVNDVIQPNGTVEGVTAIRDGEALEYRSEIVIDGAGALSVLQDKADLSASSFD
TNVNYSQFCSAYREVLEVPEPVEWDDALVFKPTEELGYLWYFPRSATEINAGLGFQMSQE
PMELVDVLKDDIANRAEFQDATVKNKLGAALPTRRPYDSAVHPGYVAVGDAAGHVNPCTG
GGIPGAAKGGHWAAKIAVDAISDGDVSEAALWEYNQRVQTDFGKRFAAMDLYNIFGTAQE
LDDLVSILTAMPGQQLVDAIGKKGTADMSLGLKLKTLIKTFGHWDTLYDLYKVQRAAGSL
KGVYDSYPDSPDHFDAWRSERDSVLDRVYDISGAEPKY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggctaccgaggcctacgatatcgtggtcgtcggcgggggaactgccggctgc
ttcgctgcgacgaccgctgccaaggaggggctcgacgtcgtcctcctcgagcgcaaaacc
gaggaggaagggggctacatcgcctgtggggacggcatcaaggggaagagctctttcccc
gacgtgctcgatcgtgaacgactcaaagacgaggcgttcaccaaccaggggatcgaacgc
gccatcttcgaaaacccacagaccaacgagcgcctcgacatcccgttcaacgagaccggc
ggcgttgtcgaccgctggaagtacggccagatcctcctggaggaaaccgaccgcgccggc
gtcgacatccactacaacaccgtcgtcaacgacgttatccagcccaacggcaccgtcgag
ggtgtgactgcgattcgggacggcgaggcactcgagtaccgatctgaaatcgtcatcgac
ggtgcgggtgcgctctcggtgttgcaggataaggcggacctctcggcgtcgtcgttcgac
accaacgtcaactactcgcagttctgctcggcctaccgcgaggtactcgaggtgccagag
ccggtcgagtgggacgacgcgctcgtcttcaagccgaccgaggaactgggctatctctgg
tacttcccgcgctcggcaacggagatcaacgcgggactgggcttccagatgagccaggag
ccgatggaactggtcgatgtgctcaaagacgacatcgccaaccgggcggagttccaggac
gcgacggtgaagaacaaactcggtgccgccctcccgacccgccggccgtacgactcggcg
gttcaccccggctacgtggccgtcggcgacgcggcggggcacgtcaacccctgtaccggc
ggtggtattccgggtgccgcaaaaggtggccactgggcggcgaagatcgctgtcgacgcg
atttccgacggcgacgtgagcgaggcggccctctgggagtacaaccagcgcgtccagacg
gactttgggaagcgcttcgcggcgatggacctctacaacatcttcggcaccgcacaggaa
ctggacgacctcgtctcgatcctcacggcgatgccgggccaacagctcgtcgacgcgatc
ggcaagaaggggactgccgatatgagcctcggcctcaagctcaagacgctgatcaagacc
ttcggtcactgggatacgctctacgacctctacaaggtccagcgggccgccggctcgctc
aagggcgtctacgacagctatccggacagccccgaccacttcgacgcctggcgctcggag
cgcgatagcgtgctggatcgagtgtacgatatcagcggcgctgagccgaagtactaa

DBGET integrated database retrieval system