KEGG   Natrialba magadii: Nmag_0671Help
Entry
Nmag_0671         CDS       T01176                                 

Definition
(GenBank) Amidase
  KO
K02433  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nmg  Natrialba magadii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nmag_0671
Enzymes [BR:nmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Nmag_0671
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Nmag_0671
Mitochondrial biogenesis [BR:nmg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Nmag_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
666475..667986
Genome map
AA seq 503 aa AA seqDB search
MSRERYETAGIGEAALTRLSATELASRIREGEVTATEAVEAHLDQVDARDDEINAFVTVC
ADEAREAAAEADRVLESAEADAPDGCDDSDGGNGDDGDEQIGPLHGVPIALKDLGSLKES
LPYTFGSALFSDFVAPKTAVTVARLEEAGAIVLGTTNTPEFGHKGTTTNDVIGATASPID
TELNAGGSSGGSAAAVAAGMTPVATGSDAGGSLRIPAAACGVYGFKPTFGLVPSVSRPNG
FGRARHHVTKGPLSRTVADSAALLSEMAGHHPDDPESVPVDIAFRDAVQEPSTDLRIAYS
PALDVFPVTDAVRTVVDDAVASLEDAGATVEEVAVDHGYELDELIEAVIPTFTTSMLESA
TVTAESHGIDLREHPETVTDSLLRMLELGEQYGPADIARSDIARTAIFDAVQEVLSEYDL
LATPTLSRADVGLHEDLDAEAWEWPLTWPFNWTGHPAASAPAGLTEAGHPVGLQLVGPRF
GDDTVLAGSTVLESQRPWDHLYD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgagcgctacgaaacggctgggatcggcgaggcggcactcacgcggctgtcg
gcgaccgaactcgcgagtcgcattagggagggtgaggtaaccgccaccgaggcagtcgag
gcacacctcgaccaagtcgacgcgcgcgacgacgagatcaacgccttcgtcaccgtctgc
gctgacgaggcgcgcgaggcagccgccgaagcggaccgggtactcgagtccgccgaggct
gacgccccggatgggtgcgacgacagcgacggcggaaacggcgacgacggcgacgaacag
atcggccccctccacggcgtcccaatcgcgctcaaggacctcggctcgctgaaggagagc
ctgccctacaccttcggctcggcactgttttccgacttcgtggcacccaaaacggccgtc
accgtcgcgcgactcgaggaggccggtgcgatcgtgctcgggacgacgaacacgcccgag
ttcggccacaaggggacgacgaccaacgacgtgatcggggcgacggcgtcgccgatcgac
accgaactgaacgcgggcggctcttccggcggctccgcggcggcggtcgcagcggggatg
acacctgtcgcgaccggtagtgacgcgggcggttcgcttcgcattccggcagccgcctgc
ggcgtctacggcttcaagccgacgttcggtctcgtgccctcggtcagcagacccaatggc
ttcggccgggcgcgccaccacgtcacgaaggggccgctctcgcgcacggttgccgactct
gccgcgctcctctcagagatggctggccaccatccggacgaccccgagagcgttcccgtc
gatatcgcgtttcgggacgctgtgcaggagccctcaaccgacctgcggatcgcctacagc
ccggctctcgacgtcttcccggtcacggacgcggttcgcacagtcgtcgacgacgcggtg
gcgtcgctcgaggacgcaggtgccaccgtcgaggaggttgctgtcgatcacggctacgaa
ctggacgaactcatcgaggcggtgatcccgacgttcacgacctcgatgctcgagagcgct
accgtcaccgcggagtctcacgggatcgacctgcgcgagcaccccgagacagttactgac
agcctgctccggatgctcgaactgggcgagcagtacggccccgccgacatcgcccgctcg
gatatcgcccggacagccatcttcgacgccgtacaggaggtgctgtccgagtacgacctg
ctcgcgacgccaaccctctcgcgcgccgacgttggcctccacgaagacctcgacgcagaa
gcctgggagtggccgctcacctggccgttcaactggaccggccaccccgccgcctccgca
cctgccgggctcacggaggcaggacaccccgtcggactccagctcgtcggcccccgcttc
ggagacgataccgtgctcgccgggagcacggtactcgagtcccagcgtccctgggaccac
ctgtacgactga

DBGET integrated database retrieval system