KEGG   Natrialba magadii: Nmag_0677Help
Entry
Nmag_0677         CDS       T01176                                 

Definition
(GenBank) protein of unknown function DUF354
  KO
K09726  uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF354 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_28 Flagellin_N
Motif
Other DBs
NCBI-ProteinID: ADD04262
UniProt: D3SZC8
Position
complement(672406..673497)
Genome map
AA seq 363 aa AA seqDB search
MRCLFFNNTPAHVHLYKHTVSRLEDAGHEVLVLARGDECTEALLSYHDVPYETYGDRSDS
LQSLLWEVPAHLSMIARRARQFDPDVVFGIGPYAAYTGTITRAPAVAVLDSEPSLDHVVS
KPFVRAILTPEAFRKDLGSKHYRFRGFKESAYLHPDVFEADESVRADLGVDADEPYVIVR
LNAFNGHHDVGKRGFSVEQRRQLLSALADHATVFVSDEGGDLELDDLDDLDVRPYDLHPA
RIHDALAEAELFVADTQTMVTEAALLGTPAIRSNSFVGEDDMGNFLELEKHGLIDNCSEF
ETVLARAQELLTDESTAETWAKRRDSYTEEMVNLTEIITSIAESYSEPSAHPATAEVTGV
RAD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctgtctcttctttaacaacacgccggcacacgtccacctgtacaaacacaccgtg
tcacggctcgaggatgcgggtcacgaggtgctcgtgctcgcgcggggagacgagtgtacc
gaagcgttgctctcgtatcacgacgtgccctacgaaacctacggcgaccgcagcgactcg
ctccagtcgctgctctgggaggtgccggcgcacctctcgatgattgctcgccgggcacgg
cagttcgatccagacgtcgtcttcggaattggaccctacgctgcctacacgggcacgatt
acgcgcgcgccagcggtcgccgttctcgactccgagccctcgctcgaccacgtggtttcg
aagcccttcgtgcgcgcaattttgacacccgaggcgttccgaaaggatctcggctcgaaa
cactaccggttccggggcttcaaagaatcggcgtacctccaccccgacgtcttcgaggcg
gacgaatcggtcagagcagacctcggcgtcgacgcggacgaaccgtacgtcatcgtcagg
ctcaacgcgtttaacggtcaccacgacgtcggcaagcgcgggttctctgtcgagcagcgc
cggcagctgctgtcggcgctcgccgaccacgcgaccgtcttcgtctcggacgagggcggg
gatctggaactcgacgatctcgacgatctcgacgtgcgtccgtacgacctccatcccgcc
cgaattcacgacgcgctggcggaggcagaactattcgttgccgatacacagacgatggtc
accgaggccgccctgctcggcacgcccgcgatccgctcgaactccttcgtcggcgaggac
gacatggggaacttcctcgaactcgagaagcacggactcatcgacaactgcagcgagttc
gagactgtcctcgcccgcgcacaggagttgcttacggacgagtcaacggccgagacgtgg
gcgaagcgacgcgacagctacacggaggagatggtcaacctgaccgagatcatcacgtcc
atcgcagagtcctacagcgagccgagcgcacatccagcgacggccgaggtaacgggggtg
cgtgcggactga

DBGET integrated database retrieval system