KEGG   Natrialba magadii: Nmag_0688Help
Entry
Nmag_0688         CDS       T01176                                 

Definition
(GenBank) Protein of unknown function DUF63
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF63
Motif
Other DBs
NCBI-ProteinID: ADD04273
UniProt: D3SZD9
Position
681986..683113
Genome map
AA seq 375 aa AA seqDB search
MYETVERYGPLKVWALTVVALAAAVIFAATAFPERVYVDIIWQYYWGPVVADAHGWSEVA
WADGEQIPASEAGPDAGPTASPGYTFVSYAGYIPTLILGVIGIVFLIDRLEIERYRAGFY
GLFPFMLFGGALRVVEDANVAAYRETGELAIQLPWSGLLISPLIYFVVFFIAFVAVVVSV
WLERNDYVPGYEYPLGAIGTVLLTGTVGYLGYLAWAEPYATFYPWLLIVTLVGATVATWL
TWKATHAFMPGIHRGTMFMGAVVIWAHAVDGVANVIGLDWATAFGHEHNLLPKHPVNEAI
VDTTGSLLPADVVAVTGAAWPFLLVKLAAAVFVIWIFDETVFEESPRYTILLLITVVAVG
LGPGTRDMLRATFGV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagaccgtcgaacggtacggcccgctcaaagtctgggccctcaccgtcgtcgca
ctcgccgccgcggtgatattcgccgcgaccgcgttcccggagcgggtgtacgtcgatatc
atctggcagtactactggggtcccgtcgtcgccgacgcccacggctggagcgaggtcgcc
tgggctgacggtgaacagatccccgccagcgaagccggccctgacgccggcccaactgcg
tcaccggggtacacgttcgtctcctacgccggctacatcccgacgctcatcctgggtgtc
atcgggatcgtcttcctgatcgaccgactcgagatcgagcgctatcgcgccggcttctac
ggactctttccgttcatgctcttcggcggagccctgcgtgtcgtcgaggatgcgaacgtc
gccgcctaccgcgaaaccggtgagctcgcaatccagctgccgtggtccggcctgctgatc
agtccgctcatctacttcgtggtgttcttcatcgcgttcgtcgcggtcgtcgtctcggtc
tggctcgagcgcaacgactacgtcccgggctatgagtacccgcttggagcgatcgggacg
gtgttgctcaccggcacggtcggctacctcggctatctcgcctgggcagagccctacgcg
acgttctatccgtggctcctcatcgtgacactcgtcggtgcgacagtcgcgacgtggctc
acctggaaggcaacccacgcgttcatgccaggcatccaccgcggaacgatgttcatgggc
gcggtcgtcatctgggcgcacgccgtcgacggtgtcgcgaacgtcatcggcctcgactgg
gcgacggcgttcggacacgagcacaacctgcttccgaagcacccggtgaacgaagcgatc
gttgacacgaccggctcgctccttccggcggacgtcgtcgctgtaaccggcgcagcgtgg
ccgttcctcctggtcaaactcgccgctgcagtgttcgtgatctggatcttcgacgaaacg
gtcttcgaggagagtccacgctatacgatcctcctgctcattacggtcgtcgcggtcggt
ctcggtcccggaacgcgtgacatgctccgggcaacgttcggcgtctga

DBGET integrated database retrieval system