KEGG   Natrialba magadii: Nmag_0691Help
Entry
Nmag_0691         CDS       T01176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL Patched Sterol-sensing SecD_SecF
Motif
Other DBs
NCBI-ProteinID: ADD04276
UniProt: D3SZE2
Position
685991..688408
Genome map
AA seq 805 aa AA seqDB search
MGDGLLQRTLGALTYWITDRPKAVIVAFLLLTALFVGGLGQIEMDEDIDTFADGVPAQEA
SDAVDKEFEPPFESDAPTTQLIQRGENVLTRDALLRLLEFQQHVEQQDEFRVTETASTAQ
AVAQSIDPTASTLDEQIRALERTDDGTVRETVRDLADEPSFAASLSEDFSPQDPSASATV
ATATHESDTNTQDVQFELQDVADSADGEIVVFGGGIFDAEFENVIEDSLGIIIPVVIVLI
LIFLIVAYRDPFDLVLGLVALVMAVIWTFGFTGYAGIPFTMMMIAIPPLLLAVGIDFGIH
AVNRYREERITGSSIKNSMEDAAEQLLVAFFIVTGTTVIGFGANVTSDLGPIREFGFVAS
VGIIFTFLIFGIFLPAVKVWLDRLRRRHDLPSFSTSPLGSEDSALGRYLPAGAHLGKRAP
IAMLLIALLVTGGAGAYATTVDTTFEEEDFLPPEEIPGYIEAAPEPLAPSEYTATETITY
LDDNFESGEDDQVTVYVEGPIYEDHVLESVYRAGEDPPSTIVTEDSVADSESIIDVMHDH
ADQDEEFAHLLAANDMSNTGVPDRNVGHVLDQLLQSDSREAALEYITEDQRSMRVIYTVE
AGATQEEVTGDAEELASDFRLETTPTGDIVVFHEISDLIFESSMLSLALALVLTAVFLMV
IYHVLEGRASLGIANLVPIVVTVAVLGGTMPLFDLPLNALTGTALSITIGIGVAYSVHVT
HRFIDEFNECGDGYTALVTTMQGTGGALTGSMLTTLGGAGSLILAITPIIGQFGLVMVIS
VIYSYLMAIIVLPPTLLVWERVCGS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggactcctccagcgcaccctcggggcactcacctactggataaccgaccgg
ccgaaggcggtaatcgtcgccttcctgctcctcacagcgctgtttgtcggcggtctcggt
cagatcgagatggacgaggacatcgacacgttcgccgacggtgtcccggcacaggaagcc
agcgacgcggttgacaaggagttcgaaccgccgttcgagtccgacgcgccgacaacgcaa
ctcatccagcgcggcgagaacgtgctcacccgggacgcgttgctccggttactcgagttc
caacagcatgtcgaacaacaggatgagttccgcgtcaccgagacggcgagtaccgctcag
gcagtcgcccagtcgatcgatccgacggcatcgacgctcgacgagcagattcgggcgctc
gaacggacggatgatgggaccgttcgcgagacggttcgcgacctcgccgacgaaccgtcg
tttgcggcctcgctgagcgaggacttcagcccgcaagacccttcggcgtcggccacagtg
gcgacggcaacccacgagagcgacaccaacacccaggacgtccagttcgaactgcaggac
gtggctgactcagcggacggtgagatcgtcgtcttcggtggcggtatcttcgacgcggag
ttcgagaacgtgatcgaggactcgctgggcattatcatcccggtcgtgatcgtcctcatt
ctgatctttctgatcgtcgcctatcgggatccgttcgacctcgtgttgggtctggtcgcg
ctcgtgatggccgttatctggacgttcggcttcaccggctacgccgggattccgttcacc
atgatgatgatcgcgattccgccgctgttgctcgcggtcggaatcgatttcggcatccac
gcggtcaatcgctaccgcgaggaacggattacgggttcgagtatcaagaacagcatggaa
gacgccgcagagcaactactcgttgcgttcttcatcgtcacggggacgaccgtcatcggc
ttcggcgcgaacgtgacgagcgatctcggtccgatccgcgaattcggcttcgtggccagc
gtcgggattatcttcacgttcctgatcttcggcatcttcctgcccgcggtgaaggtctgg
ctcgatcgcctgcgccgacgacacgacctcccctcgttcagcacgtcaccgcttggctcc
gaagactctgcactcgggcgctacctccccgctggcgcacacctcggcaaacgcgcaccg
atcgcgatgttgctcattgcactgctcgtgactggtggcgcgggcgcgtacgcgaccacc
gtcgacacgacgttcgaggaggaagacttcctcccgccggaggaaatccccggctacatc
gaggctgcgcccgagccgctcgccccttcggagtacactgcaaccgagaccatcacctac
ctcgacgacaacttcgagagcggcgaggacgaccaggtcaccgtctacgtcgaggggccg
atatacgaggatcacgtcctggaatccgtctatcgcgccggcgaggatccgccctcgacc
atcgttaccgaggactcggttgccgacagcgagagtatcatcgacgtcatgcacgaccac
gccgaccaggacgaggagttcgcccacctcctcgcagccaacgacatgagcaacaccggc
gtccccgaccgcaacgtcggccacgtcctcgatcagttgctccagtccgactcgcgcgag
gcggcactcgagtacatcaccgaggaccagcgcagcatgcgcgtgatctacacggttgag
gcgggtgcgacccaggaggaggtgacgggtgacgccgaggagttggcttcggacttccga
ctcgagacgacgccaacgggggatatcgtcgtcttccacgagatttcggacctgatcttc
gagtcgtcgatgctcagtcttgcactggcgctcgtattgacggcagtgttcctgatggtg
atctaccacgtactggaggggcgggcctcgcttggaatcgcgaacctcgtgccgatcgtg
gttaccgtcgcggtgctcggcgggacgatgccgctgttcgatctgccgctgaacgcactg
accgggacggcgctgtcgatcacgattgggatcggcgtcgcctattcggtccacgtcacc
caccgattcatcgacgaattcaacgagtgtggcgacggctacacggcgctggtgacgacg
atgcaggggaccggtggcgcgctaacgggctcgatgctgacgaccctgggcggggcaggc
tcgctcatcctggcgattacgccgatcattgggcagttcgggctggtgatggtaatcagc
gtcatctactcgtacctgatggcaattatcgtcctgccaccgacgctgttggtctgggaa
cgggtgtgtgggtcgtag

DBGET integrated database retrieval system