KEGG   Natrialba magadii: Nmag_0692Help
Entry
Nmag_0692         CDS       T01176                                 

Definition
(GenBank) amino acid permease-associated region
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Usp AA_permease_C
Motif
Other DBs
NCBI-ProteinID: ADD04277
UniProt: D3SZE3
Position
688707..691169
Genome map
AA seq 820 aa AA seqDB search
MTGSDEELAKDLGLVSALAIGIGTMIGAGIFVLPGIAAQEAGPLVVVSFIIGGMIAMINA
FSVSELGTAMPKAGGAYYYINRALGPLFGSISGMGDWIGLAFASAFYSIGFGGYLADLLD
GVVVPIPGVGELALLPTIAIGPLVLTEIQIGAVIAGVVFVGVNYIGAKETGGIQTIIVTL
LLGLLTVFAIVGFFSFDWGTVTADGSYAPEGVGAMLPGAALVFVSYLGYAKIATIGEELK
NPGRNLPIAIIGSVGIVMVIYAILVGLLMGLIPHEEFFLDTVEDAPMSYAAEIVFDYQLP
VAGFEIPILGIGVTSITLAALLATASSANASILASARINFAMGRDKIVTDSLNEIHPRFA
TPYRSIAITGGLIIIFIIGLGETVEILSSAASVLHLVVYALINASLIVFRETNPPEYDPD
FEVPFYPYLPISGFVLSLGLIYYMDRTATLIAGAFVVFAIVWYFAYARTETNLEGLLGTY
ILDRSAEMPDAAVTAASAVKPTDEDEHTVVVPVSNPRTESELLSLASVLAKANDGRVQAV
HIVEVPDQTPLEEGSEHMRRIDAESQKLMSNVEQSTETLDVPVEVRTVVSHRSFDEVFNV
AQRENADTVVMGWGPDRPWSAGRAERPLDELTHELPCDFLVLNDRGFDAERVLVPTAGGP
TSELSAEVARDFREQVGAEVTLLHVVDEGTSQQDGEAFLREWATEQGLEDAAIRIDTSGD
VESAIATAARDHSLVVIGATERGLLSRLFRGSLAYDVVNEVDCSVLLAERPTSRSLRDRL
FGREHERTDGDTNTDTGTGTDTDTGTGTGTSSESKLESDT
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagcgacgaggaactcgcgaaagacctcgggctggtctcggcactcgcgatc
ggtatcgggaccatgatcggggctggaatcttcgtccttccgggtatcgccgcacaggag
gccggcccgctcgtcgtggtctcgtttatcatcggcggtatgatcgcgatgatcaacgcc
ttctccgtgagtgaactgggaacggcgatgccgaaagctggcggagcgtactactacatc
aaccgagcgctcggcccgctgttcggctctatttcggggatgggcgactggatcggactc
gcctttgcaagcgcgttctacagcatcggtttcggtgggtatcttgccgacttactcgat
ggtgtcgtcgtcccgattcccggtgttggtgaactcgcacttctcccgacgattgccatc
ggcccgctcgttctcactgaaattcagatcggagcggtcatcgccggtgtcgtattcgtc
ggcgtcaactacatcggcgcgaaggagacgggcggcattcagaccattatcgtgacgctc
ctcctcggtctcctcacggttttcgccatcgtcggcttcttctcgttcgactggggcacc
gtcaccgccgacggcagctacgcgcccgagggcgtcggcgcgatgctccccggcgcggcg
ctcgtgttcgtctcctacctcggctacgcgaaaatcgcgactatcggcgaggaactcaag
aacccaggccggaatcttccgattgcaatcatcggcagcgtcggtatcgtgatggtcatc
tacgccatcctcgtcggcctcctgatgggactgatcccacacgaggagttcttcctcgat
acagtcgaggacgcgccgatgtcctacgccgccgaaatcgtcttcgactaccagttgccg
gtcgccggcttcgaaatcccgatcctcggtatcggtgtgacctcgattacgctcgcggca
ctgctcgcgaccgcctcgagtgcgaacgcgtcgatcctcgcgtccgcgcgtatcaacttc
gcgatgggccgtgacaagatcgtcaccgactcgctcaacgagattcacccccgattcgcg
acgccgtaccgctcgatcgccatcaccggtggcctgatcatcatcttcatcattggcctc
ggtgagacagtcgagatcctctcgagtgcagccagtgtgctccacctcgttgtctacgca
ctgatcaacgcctcgttgatcgtcttccgcgagacgaacccgccggagtacgatcccgac
ttcgaggtgccgttctacccgtacctgccgatttccggtttcgtcctctcgctcgggttg
atctactacatggaccgaacggcgaccctgatcgccggcgcgttcgtcgtcttcgcaatc
gtatggtacttcgcgtacgcgcgaacggagactaatctcgagggactactcgggacgtac
atcctggaccgctccgccgagatgccggacgcggccgtgaccgcagcgagtgccgtcaaa
cccacggacgaggacgaacacaccgtcgtcgtccctgtctcgaatccacgaactgagtcc
gaactgctctcgctcgcgagcgtgctagcgaaggcaaacgacggccgcgtccaggccgtc
cacatcgtcgaggtgccagatcagacgccactcgaggagggctccgaacacatgcgacgc
atcgacgcagagtcccagaaactgatgtcgaacgtcgagcagagtacggagacgctcgac
gtccccgtcgaggttcggacggtcgtctcccaccggtcgttcgacgaggtgttcaacgtc
gcccagcgcgagaacgccgatacggtcgttatgggctggggtccagaccgaccgtggtct
gcgggtcgtgccgaacggccactggacgaactcacgcacgagctgccgtgtgacttcctc
gtgctcaacgaccgcggcttcgatgccgagcgcgtgctggtgccgacggctggtggcccc
acctccgagctgagcgccgaagtcgcacgggacttccgcgagcaagtcggcgcggaggtt
accctcctgcacgtcgtcgatgaggggacgagccagcaggatggcgaggccttccttcgc
gagtgggcaaccgaacaggggctcgaggatgcggcgatccgtatcgatacctccggcgac
gtcgaatccgcaattgcgacggcagcccgtgaccactcgctggtcgttatcggcgcaacc
gagcgtggcctgctctcgcggctgttccgtggctcactggcctacgacgtggtcaacgaa
gtcgactgttcggttctgctcgccgaacgaccgacctcgcggtcgcttcgtgatcggctg
tttggccgggaacacgagcgtactgacggcgacaccaacactgacaccggcaccggcacc
gacaccgacaccggaaccggaaccggcaccagcagcgaaagcaaactcgagagcgacacc
taa

DBGET integrated database retrieval system