KEGG   Natrialba magadii: Nmag_0694Help
Entry
Nmag_0694         CDS       T01176                                 

Definition
(GenBank) fibrillarin
  KO
K04795  fibrillarin-like pre-rRNA processing protein
Organism
nmg  Natrialba magadii
Brite
Ribosome biogenesis [BR:nmg03009]
 Prokaryotic Type
  Sno RNPs
   Box C/D snoRNPs
    Nmag_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fibrillarin
Motif
Other DBs
NCBI-ProteinID: ADD04279
UniProt: D3SZE5
Position
692255..692908
Genome map
AA seq 217 aa AA seqDB search
MRNALPDGVERHAFGGDGDGDGDCRLATRGEPVYGEPTDGEWRAWDPSRSKLGAMLELEM
ETNLAGGDTVLYLGAASGTTVSHVADFAGPTYAVEFAARPARDLLEAAASRPRLFPLLAD
ARKPDTYAHVVESDIDVIVQDVATRGQARVALENRRFLADDGRLLLAVKARSEDVTRDPA
AVFDDVREELEAEYEVLETKSLERYHADHLGIVARPL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgccctccccgacggcgtcgagcgccacgcgttcggcggcgacggcgatggc
gacggtgactgccgcctcgccacccgcggcgagcccgtctacggcgaacccaccgacggc
gagtggcgcgcctgggatcccagccgctcgaaactcggcgcgatgctcgaactcgagatg
gagacgaatctggctggcggcgacaccgtcctctacctcggcgcggcgagtggaaccacg
gtgagccacgtcgcggatttcgccggcccaacgtacgccgtcgagttcgcggcccgaccg
gcccgagacctcctcgaggcggcggcctcgcgtccgcggctgttcccgctgctcgcggat
gcccgcaagccagacacctacgcccacgtcgtcgaatcggacattgacgtcatcgtccag
gacgttgccacgcgcgggcaggcgcgagttgcactcgagaaccgtcggttcctcgcggac
gacggccgactgctgctcgcggtcaaggcccggagcgaggacgtaacacgtgatccggcg
gcggtgttcgacgacgtgcgcgaggaactggaagctgagtacgaggtactcgagacgaag
tccttagagcggtatcacgcggatcatctggggatcgtggcgcggccgctatga

DBGET integrated database retrieval system