KEGG   Natrialba magadii: Nmag_0695Help
Entry
Nmag_0695         CDS       T01176                                 

Definition
(GenBank) transposase, IS605 OrfB family
  KO
K07496  putative transposase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_IS605 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ADD04280
UniProt: D3SZE6
Position
complement(693006..694283)
Genome map
AA seq 425 aa AA seqDB search
MKRANTFEVIPQSDEDEELLRRLLDASAALWNEINYERRENYADPDGDVWDISEYRGRYG
GVLGASTVQQIERKNREAWKSFFSLKKKGEANGKPGFWGNVDEGRELRTYIRNTSYSVEW
GEYSRLEILVGQDLKNEYGLGHRERLRLEVRGDPNWKEYENQGRLELFYDEQAQTFRAFQ
PVTVDDSRLAQPLASEEAALDIGANNLVACTTTTGQQYLYEGRDLFKRFRETTREIARLQ
SLLEDGRYSSHRIRRLYDRRTKRRDHAQDALARDLIEHLYDEGVSTVYVGALTDVLETHW
SVETNAKTHNFWAFRAFVNRLACTAEEYGISVEVRSEAWTSQECPNCGSTEDTTRHRDTL
MCPCGFEGHADLVASETFLRRQTTVTRSMARPVCLKWDNHEWLESSRSPRPNEEHTNPQV
ASVGR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagccaacacgttcgaggtgattccgcagtccgacgaggacgaggagttgctt
cgacgcctgttggacgcttctgccgctctctggaacgaaatcaactatgagcgccgcgag
aactatgctgacccagacggagacgtgtgggatattagcgagtatcgcggtcgctatggc
ggtgttctcggcgcgtccacggttcagcaaatcgaacgcaagaaccgcgaagcgtggaag
tcgttcttcagcctcaagaagaagggcgaagccaacggaaaacccggattctggggtaac
gtagacgaaggtcgagaactccgcacgtacatccgaaacacgtcgtactccgtcgagtgg
ggcgaatactcccgcctcgaaattctcgtcggtcaagacctgaaaaacgaatacgggttg
ggacaccgcgaacgtctccgccttgaagttcgaggcgaccccaattggaaggagtacgag
aaccagggtcggttggagttgttctacgacgagcaagcacagacattcagggcctttcag
ccagtcaccgtcgatgattctcgactggcacaaccactggcttcggaagaagccgctctg
gatattggtgcgaacaacctcgtcgcctgcacaaccacaaccggccagcaatatctgtac
gaaggacgcgacctgttcaaacgattccgcgagacgacgcgagaaatcgcccgcctccaa
tcactcttggaggacggtcgatacagcagtcaccgaatccgacgcctgtacgaccggcgc
accaagcgacgtgaccacgctcaagacgcactcgcgcgtgacctcatcgaacatctgtac
gacgagggtgtttcgacagtgtacgtcggggcgctgacggacgtgcttgagacgcactgg
tcggtagagacgaacgccaagacgcacaacttctgggcgtttagagcgttcgtgaatcga
ctggcgtgtaccgctgaggaatacggtatctcggtggaagtgcggtctgaggcgtggacg
agtcaggagtgtccgaactgcggttcgacagaggacacgacacgtcacagagacactctg
atgtgtccgtgtggcttcgaggggcacgccgacctcgtggcgtcagagacgttccttcgg
cggcagacaacagtaacacggtcgatggcacggcctgtatgcctcaagtgggacaaccat
gaatggttggagtcatcacgctctccccgtcccaacgaggagcatacgaacccgcaagtt
gcctccgtgggtcggtag

DBGET integrated database retrieval system