KEGG   Natrialba magadii: Nmag_0696Help
Entry
Nmag_0696         CDS       T01176                                 

Definition
(GenBank) hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mhr1
Motif
Other DBs
NCBI-ProteinID: ADD04281
UniProt: D3SZE7
Position
694325..694474
Genome map
AA seq 49 aa AA seqDB search
MCCCMVEVRIEFDDDEQYERLKELKKHRGLTWKGLLLEGEKKVREDTPE
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgctgtatggtcgaagtccgcatcgagttcgatgacgatgaacagtacgagcgg
ttgaaagaactgaagaagcaccgcgggttgacgtggaagggattgctccttgagggcgaa
aagaaagtccgggaggataccccggagtaa

DBGET integrated database retrieval system