KEGG   Natrialba magadii: Nmag_0697Help
Entry
Nmag_0697         CDS       T01176                                 

Definition
(GenBank) Pyrrolo-quinoline quinone
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_3 PQQ PQQ_2 DUF5050 WD40_like
Motif
Other DBs
NCBI-ProteinID: ADD04282
UniProt: D3SZE8
Position
694720..695967
Genome map
AA seq 415 aa AA seqDB search
MNGLCDRRAFLASAATGGMLGLAGCLSGDAEQVSTDDVTPSVPSADPDADVSWESFQYDA
ANTGHAPGVGPTAEVETLWKFPTDDSVYSSPAVVDGTVYVGSMDGSLYAIGADDGDERWS
FATGESITSSPAVVDGTVYVGSMDGTVYALPADEDGTQPDPTWTFETDEGVAASPTVADG
VVYAGSNDGYLYALDADDGELLWAFEAEDSVMRAPAVADGTVYFGSTDNFLYAIDIDTEG
ERARWRVETDDRIQSRPTVADGVVYVGSNDDLLYAVEADSGDIRWTFQTGGSVTASPAVT
EHAVYAASFDNYVHALSSTAGPAPDDDDETASPETYFWAESGFQGVRSSPVVVGDALYVG
NENGAVRSLSAETGETNWQFQTESWVAASPAVVDGVVYVGSGDGSVYALAETDSS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaacggactgtgcgaccgacgagcgtttctggcgagtgcagcgacggggggcatgctc
gggctggcgggctgtctctccggcgatgctgaacaggtgagtaccgacgacgtgacgccg
tcggttccgtcggccgatccggatgcagacgtttcctgggagtcgttccagtacgacgcg
gcgaacaccggtcacgcgccgggcgtcggcccgacagccgaagtggagacgctgtggaag
ttcccgacggacgatagcgtctacagcagtccggcggtcgtcgacggaacagtgtacgtc
ggcagcatggacggctcgctgtacgccatcggggcagacgacggcgacgagcgctggtcg
ttcgcgactggcgagtcgatcacgagcagtccggcggtggtcgacgggacagtgtacgtc
ggcagtatggacggaacggtgtatgcgttgccggcagacgaggacggaacgcagccggac
ccgacgtggacgtttgagaccgacgagggcgtcgccgcgagtccgaccgtcgcggacggt
gtcgtctacgccggcagcaacgatggctacctctacgcgctcgacgccgacgacggcgaa
ctgctgtgggcgttcgaggctgaagactccgtcatgcgtgcgcccgcggtcgcggacggg
acggtgtatttcggaagtaccgacaatttcctctacgcgattgacatcgacactgagggt
gagcgtgcgcgctggcgcgtcgaaacggacgaccgaatccagagcagaccgaccgtcgca
gacggcgtcgtctacgtcgggagcaacgacgatctgctgtacgcagtcgaagctgactcg
ggcgacatccgctggacgttccagactggcggctcggtgacggcgagtccggccgttacg
gagcacgcggtctacgccgcgagcttcgacaactacgtccacgccctctcgtcgaccgcg
ggaccggcgccggacgacgatgatgagaccgcgagccccgagacgtacttctgggccgag
agcggtttccagggagtccggagcagtccggtcgtcgtcggcgacgcactctacgtcggc
aacgaaaacggtgccgtacgctcgctgtcggcggagacgggcgagaccaactggcagttc
cagactgagagctgggtcgccgccagtccggctgtcgtcgacggcgtcgtctacgtcggt
agcggcgatgggtcagtgtacgcactcgccgagacggacagtagttga

DBGET integrated database retrieval system