KEGG   Natrialba magadii: Nmag_0700Help
Entry
Nmag_0700         CDS       T01176                                 

Definition
(GenBank) putative transcriptional regulator, AsnC family
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C HTH_AsnC-type HTH_24 HTH_11 HTH_20 HTH_DeoR MarR_2 HTH_5 Rrf2 HTH_28 MarR HTH_36
Motif
Other DBs
NCBI-ProteinID: ADD04285
UniProt: D3SZF1
Position
699309..700103
Genome map
AA seq 264 aa AA seqDB search
MGNGTGGSYRLDEIDRRIIYALMSDARNTSAPAIAEEVSVSGATIRNRIAQLEEHGIIDG
YHATVDFEHADGSLMNLFLCHASFGEVEGVARRIGTIPGVINVRELMGGHMNLHVLAVGT
DTADLRRIGRELEQLDVAIEDEFLMQTEHDFPYTPYGPADGRRREPLADYISLTGGAEVV
EISVHEDAPIAGRTLESAAEDDVLADETLVVAIERDDAVITPHGDSEIRPHDVVTVFSPD
GTNEPALTAFRGPDGTAHSPTRPN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacggtaccggggggagctatcgtctcgacgaaatcgatcggcgaattatctac
gccctgatgtccgacgcgcgaaacacgtcggcacccgccatcgcagaggaagtcagcgtc
tccggtgcaacgatccgcaaccggatcgcccaactcgaagaacacggtatcatcgacggc
taccacgcgaccgtcgacttcgaacacgccgacggctcgctgatgaatctctttctctgt
cacgcatccttcggcgaagtcgagggcgtcgcacgccgaatcgggacgattccgggcgtg
atcaacgtccgcgaactcatgggcgggcatatgaacctccacgtcctcgccgtcggcacc
gacaccgccgatctccgtcgcattgggcgtgaactcgaacaactagacgttgcaatcgaa
gacgagttcctcatgcagactgagcacgacttcccctacactccctatggacccgcggac
ggccgccgccgggaaccgctcgcagactacatcagtctgaccggcggcgcggaagtcgtc
gaaatctccgtccacgaagacgccccgatcgccggccgcacactcgagtcggcggccgag
gacgatgtcctggcagacgagacactcgtcgtcgcaatcgaacgcgacgacgcggtgatc
actccccacggcgatagcgaaatcaggccacacgacgtggtgactgtcttttcgcccgac
gggacgaacgaaccggcactaacggcgttccgcgggccagatggtactgcacactcgccg
acacgaccgaactaa

DBGET integrated database retrieval system