KEGG   Natrialba magadii: Nmag_0705Help
Entry
Nmag_0705         CDS       T01176                                 

Definition
(GenBank) phosphoribosyltransferase
  KO
K00762  
orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
nmg  Natrialba magadii
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nmag_0705
Enzymes [BR:nmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     Nmag_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(703438..704115)
Genome map
AA seq 225 aa AA seqDB search
MKNVDDLIESAAELAARGLSKGEIADELNVSRETASWLVERSDATTQSESDDGAVDTAST
TDTATENGSRPQDIHVDWSAIGRDSKRLSHVAAAMADLLAKHGEDVDLTIGIEKAGGPVA
TLVARELETDLGTYTPSKHQWEEGDIENLGGTFSRNFAGIRNRECYIVDDTITSGTTMRE
TIEAIRAEGGEPLACVVLADKQGIEEIEGVPVYSLLQVISVGTDE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtcgacgatctcatcgagagcgctgccgagctggctgcgcgcgggctttcg
aagggcgaaatcgcagacgaactgaacgtctcccgcgaaactgcaagctggctcgtcgag
cgcagtgatgcgacgacgcagtcggagtcagacgacggcgcagttgacactgcatcgacg
acggataccgccacggagaacggaagccgtccacaggacattcacgtcgactggtccgcg
atcggtcgcgacagcaagcggctgagccacgtcgctgctgcgatggccgacctgctcgcc
aaacacggcgaggacgtcgacctgacgatcggaatcgagaaggccggcggcccggtcgcc
acgctcgttgcgcgggaactcgagacggatctcggcacgtacacgccttcgaaacatcag
tgggaagaaggtgatatcgagaacctcggtgggacgttttcccggaacttcgccggaatc
cgcaaccgcgagtgctacatcgtcgacgacaccattacgagcgggacgacgatgcgcgag
acgatcgaagcgattcgcgcggaaggtggcgagccgcttgcctgtgtcgtgctcgcggat
aagcaggggatcgaggaaatcgaaggtgtgccggtgtactcactcttgcaggttatcagc
gtcggcacagacgagtaa

DBGET integrated database retrieval system