KEGG   Natrialba magadii: Nmag_0706Help
Entry
Nmag_0706         CDS       T01176                                 

Definition
(GenBank) Haloacid dehalogenase domain protein hydrolase type 3
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase DUF1987
Motif
Other DBs
NCBI-ProteinID: ADD04291
UniProt: D3SZF7
Position
704280..705572
Genome map
AA seq 430 aa AA seqDB search
MERYDLVYRLYDEYDTTTLREYQEFVDIFPAVDSRVALEHWQDANDELESRKNEIRSDFA
AGETFAEIAAHTTRDQAFTALDLEAKYGRAVNVLVLDVDETLRSAGGTDNEIPRETLHVL
TEFHEAGIPIVICTGQTLENVKGFAIQGLGSEIVHSGDLSIVYEAGTGVFTPGHGADTKQ
LLYEDLDDEIRDVFDDVRSRVLPDAPADLRRGCHLQGNEFNVTMKPNYETGSTQAREIID
KALVYVLELLAESVGSILAFDGGDQTVEAENGTIELEGESITDWTHTFYADQDSEIRAVL
ESEGAYPDLDPAAVPGDLAAVLDRIDVAYYEADAAEIGSLELNKVVGVERALDVLDITDP
FALVMGDSKSDLRVMRWADENESGIAAAPEHASRDTLEHVLGTDELVFDRGRSVDVLRTV
SALNQLARLE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaacgatacgacctcgtctaccgcctctacgacgagtacgacaccaccacgttacgg
gagtaccaggagttcgtcgacatctttcctgccgtcgactcgcgagtcgcactcgagcac
tggcaggatgcaaacgacgaactcgagtcgcgcaagaacgagatccgcagtgacttcgca
gcgggcgagacgtttgcagagattgcagcacacacgactcgcgatcaggcgtttacggcg
ctcgatctggaggccaagtacggccgcgcggtgaacgtactcgtcctcgacgtcgacgag
acgctgcgctcggccggcggcacggacaatgagatcccccgcgagacgctgcacgtgctg
acggagtttcacgaagccgggatcccgatcgtcatctgtacgggccagaccttagagaac
gtcaagggctttgcgatccaggggctgggcagcgaaatcgtccactcgggcgacctctcg
atcgtctacgaggcgggcacgggcgtcttcacgccgggccatggcgctgacacgaaacaa
ctgctctacgaggatctggacgacgaaattcgggacgtgttcgacgacgtgcgctcgcgc
gtcctgcccgacgcacccgcggatctgcggcggggctgtcacctgcagggcaacgaattc
aacgtgacgatgaagccgaactacgaaaccggctctacccaggcccgcgagatcatcgac
aaagcactggtctacgtactcgagttactcgcagagtcggtgggttcgatactcgcgttc
gacggcggagaccagacagtcgaggccgaaaacggcaccatcgaactcgagggcgagtca
atcaccgactggacgcataccttctacgccgatcaggattccgagattcgagccgttctg
gagagcgaaggcgcgtacccagacctcgatccagctgccgttcccggcgacctcgcagcc
gtactcgatcgaatcgacgtcgcctactacgaggccgacgccgccgaaatcggtagcctc
gaactcaacaaagtcgtcggcgtcgaacgcgcactcgacgtactcgacatcacagatccg
ttcgcgctcgttatgggcgactccaagagcgatctgcgagtcatgcgctgggctgacgag
aacgagtccggtatcgccgccgccccagaacacgcctcacgggacaccttagagcacgtc
ctcggtacggacgaactcgtcttcgaccgcggtcgcagcgtcgacgtgttgcgaactgtg
tccgcactcaatcagctagcccgactcgagtag

DBGET integrated database retrieval system