KEGG   Natrialba magadii: Nmag_0712Help
Entry
Nmag_0712         CDS       T01176                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_4 FSH1 Abhydrolase_3 Esterase
Motif
Other DBs
NCBI-ProteinID: ADD04297
UniProt: D3SZG3
Position
complement(708615..709397)
Genome map
AA seq 260 aa AA seqDB search
METVSHQGRETAYEVSDRGGDGPTICFVHGSGGTRAVWKSQHRLADQCPVVTLDLSGHGD
SDNIDAGAGYTTLSAYADDVIAVATETDADVLVGNSLGGAVVMHILLERGDEYSPDAVVL
TGTGARLGVLEDLRNWLENDFERAVEFLHGPDCFFHDADSDLAAYSSDQLRASEQAVTQR
DFETCHTFDVRDELGGIDVPTLVVYGEHDKLTPPQYHEFLVEEIDDARSVELEDAAHMAM
LEQPAAFNEAVREFVASTVE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtatcacaccagggccgggagacggcctacgaggtttctgatcggggtggg
gatggaccgacgatctgttttgtccacggaagcggcggcacgcgagcagtctggaaatcc
cagcaccgcctcgcggatcagtgtcccgtcgttaccctcgatctgagtggccacggcgac
tccgacaatatcgatgcgggtgccggttacacgaccctctcggcctacgccgacgacgtc
atcgccgtcgcgaccgaaaccgacgccgacgtcctcgtcgggaactcactcggcggtgcc
gtcgtcatgcacatcctcctcgaacgcggcgacgagtacagccccgatgccgtcgtcctc
accggcaccggtgcccgcctcggcgtcctcgaggacctccgcaactggctcgaaaacgac
ttcgagcgtgccgtcgaattcctccacggcccggactgtttcttccacgatgccgacagc
gacctggcggcgtactcgagtgaccagctgcgcgcgtccgagcaggcggttacacagcgc
gatttcgagacgtgccatacgttcgacgtgcgcgacgaactcggtgggatcgacgtgccg
acgctggttgtctacggcgagcacgacaagctaacgccgccgcagtatcacgagtttctg
gtggaggagatcgacgatgctcggtcggtcgaactcgaggacgcggcacatatggcgatg
ctcgaacagccggcggcgttcaacgaggcggttcgtgagttcgtcgcgtcgaccgtggag
tag

DBGET integrated database retrieval system