KEGG   Natrialba magadii: Nmag_0714Help
Entry
Nmag_0714         CDS       T01176                                 

Definition
(GenBank) peptidase S8 and S53 subtilisin kexin sedolisin
  KO
K14645  
serine protease [EC:3.4.21.-]
Organism
nmg  Natrialba magadii
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Nmag_0714
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nmag_0714
Peptidases [BR:nmg01002]
 Serine Peptidases
  Family S8: subtilisin family
   Nmag_0714
Chaperones and folding catalysts [BR:nmg03110]
 Intramolecular chaperones
  Subtilisin family
   Nmag_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
710447..712498
Genome map
AA seq 683 aa AA seqDB search
MQPERRDTRSRRSILRGAGAVGGLIGATGLSSATPGRSPGPKQTELLVGINDEYARSSAN
GTERTAREAVPADATVVHSNEQLEYVAIEVPAELPSEAVEHVRDVLDSNDAIEYVEENAT
LQSLYTPNDPYYDSQHAPQQVNCEDAWAETLGDEDVTIAVVDQGVEYEHENLSGNVDDRI
GEVFVGRGSDPGPLSRGDTHGTLVAGIAAGETGNGTGQAGISNCSLLAARALDEQGQGAL
SDIADAIQWAADEGVDVINLSLGSSSGLWTLENACEYATERGCLVVAAAGNSGGSVMYPA
AYDDVLAVSALTSRDRLASFSNRGPEIDLAAPGQNLLSTTLNDGYDRISGTSAAAPVVAG
VAGLVRSVYPGLSSSALREHLRETAVDVGLRSAAQGAGRVDAGNAVTTVPEGYDGPDERD
GDTDEDEEDDEDDEETDTDGHLLSFVTEPEASFADYEFTATGPVEFTTAPGQTPSGGTIE
GGTYAAEDYIEEDDETWHAGGVTGGGQGDAFSVEGAITSIEVGQPDVMWVELDGERLSPE
EVIEETTGDDTDETDGGEEDESDETDETDEPQCGDETNTARVEGDLDGSGWWPDTARWQY
TPQTENPCELTLTVDGPSGADVELYMTRDGRRPTQWDADESATATGDTQSLTTALESDDT
VRILITATGGSGTYELEIVEQGY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagaacgacgcgatacgcgaagtcgtcggtcgatactcaggggtgctggggcc
gtcggtggactgatcggagccaccggtctctcgagtgccacgcccggtcgcagccccggg
ccgaaacagacagaactgcttgtcgggatcaacgacgagtacgcccgcagttcagcaaac
ggtaccgaacgaacagcgcgcgaagcggtgccggccgatgcgacggtcgttcactcgaac
gagcaactcgagtacgtcgccatcgaggtgccggcggaactcccatcggaggcggtcgaa
cacgttcgcgacgtgctcgactcgaacgacgcaatcgagtacgtcgaggagaacgcgacg
ctgcagtcgctgtacacgccgaacgacccgtactacgacagccagcacgcgccacagcag
gtcaactgcgaggacgcctgggcagagacgctcggtgacgaagacgtcacgatcgcagtc
gtcgaccagggagtcgaatacgagcacgagaacctgtccggaaacgtcgacgatcgaatc
ggcgaggtcttcgtcggccggggaagtgatcccgggccactctcgagaggcgacacgcac
gggacgctcgttgccggcatcgccgccggcgaaacggggaacggaacgggacaggcggga
atcagcaactgctcactgctcgccgcacgcgcgctcgacgagcagggtcagggtgcgctt
tcggacattgccgatgcaattcagtgggcagcagacgagggagtcgacgtgatcaacctc
tcgctgggaagttctagcgggctgtggacgctcgagaacgcctgtgagtacgccaccgaa
cggggctgtctcgtcgtcgcagcggccggcaacagcggcggcagcgtcatgtacccggct
gcatacgacgacgtgctggccgtctcggcgctcacgtcgcgcgacaggctcgcgtcgttc
tcgaaccgtggccccgagatcgatcttgccgcacccggccagaacctcctctcgacgacg
ctcaacgacggctacgaccgaatctccggcacatcggcggccgcgcccgtcgtcgccggc
gtcgccggactggtccggtctgtctatccggggctctcgagtagcgcgctgcgcgagcac
ctgcgggagacagcagtcgatgtcggcctcaggtcagccgcacagggtgctggccgcgtc
gatgctgggaacgcagtcacgacagtgccggaggggtacgacgggccagatgaacgagat
ggcgacacagatgaggatgaagaggacgacgaggatgacgaggagacagacaccgacggt
catctgctctcgttcgttaccgagccagaggcatcgtttgcagactacgaattcaccgcg
acgggtccggtcgagttcacgaccgcccctggacagacgccctccggaggcaccatcgag
ggaggcacgtacgccgcggaggactacatcgaggaagacgacgaaacctggcatgccggc
ggcgtgactggcggcggacagggtgatgccttcagcgtcgagggtgcgatcacctcgatc
gaggtcggccagccagacgtgatgtgggtggaactcgacggcgagcggctatcacccgag
gaggttatcgaggagacgacgggcgacgatacggacgaaacggacgggggagaggaagac
gagagcgacgagaccgacgagaccgacgagccacagtgtggcgacgaaaccaacaccgcc
cgcgtcgagggcgacctcgacggcagcggctggtggcccgacaccgcgcgctggcaatac
acgccgcagacggagaacccgtgcgaactgacgctgaccgtcgacggaccgtccggtgcc
gacgttgaactctacatgacgcgtgacgggcggcgaccgacccagtgggacgccgacgag
tctgccaccgccaccggcgacacgcagtcactcacgacggccctcgagtccgacgacacg
gttcggattctcatcactgcgacgggcgggagtggaacgtacgaactcgaaattgtcgaa
cagggctactga

DBGET integrated database retrieval system