KEGG   Natrialba magadii: Nmag_0715Help
Entry
Nmag_0715         CDS       T01176                                 

Definition
(GenBank) peptidase S8 and S53 subtilisin kexin sedolisin
  KO
K14645  serine protease [EC:3.4.21.-]
Organism
nmg  Natrialba magadii
Pathway
nmg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Nmag_0715
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nmag_0715
Peptidases [BR:nmg01002]
 Serine Peptidases
  Family S8: subtilisin family
   Nmag_0715
Chaperones and folding catalysts [BR:nmg03110]
 Intramolecular chaperones
  Subtilisin family
   Nmag_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: ADD04300
UniProt: D3SZG6
Position
712918..714543
Genome map
AA seq 541 aa AA seqDB search
MTRDTNSNVGRRSVLKAASALGAFLGLGGVASATPGREPGPKKDEIIVGVSERVSSTEAT
VESKIPTNAEIVHTNETLGYVAVKFPSNAAEQARENFKRNVLQEDDIEYAEDNATYETLE
VPNDPMYGQQYAPQQVNCEGAWAETYGDDDVVISVVDQGIQYDHENLAENMDGSVSDYGY
DFVDDDGDPYPVSAGENHGTHVGGIAAGGTNNDTGHAGISNCSMLSARALGDGGGGSLSD
IADAIQWSADQGADIINMSLGGGGFSETLDNACQYAYDEGTLLVAAAGNDHGGSVSYPAA
YDSVMAVSSLDEGETLSSFSNVGPEIELAAPGGNVLSAVNWDDYDSLSGTSMASPVAAGV
AGLALSAHPGLSNDELRDHLHDTAVDIGLSDDEQGYGRVDAELAVTTDPDNGDDDDDDDD
DEDDPGDGECGDETNTATADGELSGGWGGNPSDTYSYELSTDNPCHATVTLDGPSSGATF
DLFLTLDGRTPTTSDYDRRSYNWGADEEIEVDLDGDEELGILVDRYDGSGSYTLTIEELG
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgataccaatagtaatgtcgggcggcgatcagtactgaaagcagcaagcgca
ctgggggccttcctgggactcgggggagttgccagcgcaacaccgggacgcgagcccggc
cccaaaaaggacgaaatcatcgtcggcgtttccgaacgcgtctcgagtaccgaggcgacg
gtcgaatcgaagattccgacgaacgcggaaattgtccacacgaacgagaccctcggctac
gttgcagtcaagttcccgagcaacgctgccgagcaggcacgcgagaatttcaaacggaac
gttctccaggaggacgacatcgagtacgcagaggacaacgcaacctacgagaccctggaa
gtcccgaacgacccgatgtacggccagcagtacgcgccacagcaggtcaactgtgagggt
gcctgggcggagacctacggcgatgacgacgtcgtcatttcagtcgtcgaccaggggatc
cagtacgaccacgagaacctcgcggagaacatggacggcagcgtttctgactacggatac
gacttcgtcgacgatgacggtgacccgtacccagtcagtgccggtgaaaatcacgggaca
cacgtcggcggaatcgccgctggcgggaccaacaacgacactggacacgccggcatcagc
aactgttcgatgctttcagcacgcgcgctcggcgacggtggcggtgggtcactttcagac
atcgccgacgcaattcagtggtctgcagaccagggtgcagatatcatcaacatgtctctc
ggtggtggtggcttcagtgagacgctcgacaacgcctgccagtacgcctacgacgaagga
accctgctcgttgccgcagcagggaacgaccacggcggcagcgtctcctacccggcggcc
tacgacagcgtcatggctgtctcctcgctcgatgagggagaaacgctctcgtcgttctcg
aacgtcgggccggagatcgagctcgccgcacccggtggaaacgtcctttcggcagtcaac
tgggacgactatgactcgctgtcgggaacctcgatggcatcaccagttgccgccggtgtc
gctgggcttgcactgtcggcccatccagggctctcgaacgacgaactccgggaccatctc
cacgacaccgccgttgacatcggcctctccgacgacgagcaaggatatggccgagtggac
gccgaactggccgtcactacggatccagacaacggtgacgacgatgatgacgatgacgac
gacgaggacgatccaggtgacggagaatgtggtgacgagacgaacaccgcaaccgccgac
ggcgaacttagcggcggctggggcggcaacccgagtgacacctacagctacgaactgtcg
acggacaacccgtgtcacgcaaccgtcacactcgacggcccatcgtcaggtgccaccttt
gacctcttcctgacgctcgacggccgcacgccgacgacaagcgactacgaccgccgctcg
tacaactggggcgcggacgaagaaatcgaggtcgacttagacggcgacgaggaactcggc
atcctcgtcgaccgctacgacggcagcggttcctacacgctcaccatcgaagaactgggc
tcctaa

DBGET integrated database retrieval system