KEGG   Natrialba magadii: Nmag_0716Help
Entry
Nmag_0716         CDS       T01176                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmag_0716
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_0716
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Nmag_0716
Enzymes [BR:nmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Nmag_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
714888..715985
Genome map
AA seq 365 aa AA seqDB search
MPLQTPPLRGIHDERGAKFTEFGGWDMPVEFDSIQTEHAAVREDVGIFDVSHMGQIHVTG
PDATTLMQRLTSNDVTRLDVGDSQYATITDEDGLIIDDTVVYRLPDENGEATYLFVPNAG
TDEATHERWISYRNEFDLEATVDNQTDEYAMFAVQGPNAPDLVDEVTDESLTDVDRFTAT
MATVDGVECWTARTGYTGEDGFELIVPASEAEDIWAQFDCQPCGLGARDTLRIEAGLLLA
GQDFDLESNPRTPYETGIGFTVALDTEFVGRDALEAAREDGFDEELVGFQLIDRGIPRHG
YDITNMDGRVIGTVTSGTMSPTLDQPIGLGYVPSEYADPGTTLQVVVRGQSKKARVETIP
FIDTV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttcagacgccgcctttgcgtgggattcacgacgaacgtggtgccaagtttacg
gagtttggcggctgggatatgccggtcgagttcgactcgattcaaacggaacacgcggcc
gttcgggaggacgttggcatcttcgacgtctcgcatatgggccagattcacgttactggt
ccggacgcgacgacgttgatgcaacggctgacctccaacgacgtcacccgactcgacgtc
ggcgactcccagtacgcgacgattacggacgaagacggactgatcatcgacgacacggtc
gtctaccgcctcccggacgagaatggcgaggcgacctacctgttcgtcccgaacgctggc
accgacgaagcgacccacgaacggtggatcagctaccgcaacgagttcgacctcgaagcg
accgtcgacaatcagaccgacgagtacgccatgttcgccgtccagggtccgaacgcaccc
gacctcgtcgacgaagtcaccgacgagtcactcactgacgtcgaccggtttacagcgacg
atggcaaccgtcgacggcgtcgagtgctggaccgctcggacggggtacaccggtgaggac
ggcttcgaactgatcgtgcccgccagcgaggccgaggacatctgggcgcagttcgactgt
cagccctgtggcctcggtgcgcgagacacgctccgaatcgaagccggcctgctacttgct
ggtcaggacttcgacctcgaatccaatccgcggacaccatacgagacaggcatcggattt
actgtcgcactcgacaccgagtttgttggccgtgacgcgctcgaagccgcgcgtgaggac
ggattcgacgaggaactcgtcggcttccaactgatcgaccgcggaatcccgcgccacggc
tacgacatcacgaacatggacggccgcgttatcggcaccgtcaccagcgggacgatgagt
ccgacgctcgaccagccgatcggacttggctacgtcccgagtgagtacgcagatccgggg
acgaccctgcaggtggtcgtgcgcggccagtcgaaaaaggcaagagttgaaacgatcccg
ttcatcgatacggtttaa

DBGET integrated database retrieval system