KEGG   Natrialba magadii: Nmag_0717Help
Entry
Nmag_0717         CDS       T01176                                 

Definition
(GenBank) glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
nmg  Natrialba magadii
Pathway
nmg00260  Glycine, serine and threonine metabolism
nmg00630  Glyoxylate and dicarboxylate metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01130  Biosynthesis of antibiotics
nmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmag_0717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H
Motif
Other DBs
NCBI-ProteinID: ADD04302
UniProt: D3SZG8
Position
716053..716439
Genome map
AA seq 128 aa AA seqDB search
MSFDIPDDRQYLESHEWALETDDDTVRVGITDFAQDELGDVVFVELPDEGDDLSQEAEFG
VIESIKAVSDLYAPVGGEVVAINEELFNAPELVNDDPFGDGWMLEIDPADTDELANLLSA
DEYEAQVA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgacattcccgacgaccgacaatatctcgaatcgcacgaatgggcactcgaa
accgacgacgataccgtccgcgtcggcatcaccgactttgcacaggacgaactcggcgac
gttgtcttcgtcgaacttcccgacgaaggggacgacctctcacaggaagccgagttcggc
gttatcgagtccatcaaggcagtctctgacctctatgcccccgtcggcggcgaggtcgtc
gccatcaacgaggagttgttcaatgcgccggaactcgtcaacgacgacccgttcggcgac
ggctggatgctcgagatcgatcccgccgacacggacgaactcgcgaatctgctctcggcc
gacgagtacgaagcccaggtcgcttaa

DBGET integrated database retrieval system