KEGG   Natrialba magadii: Nmag_0717Help
Entry
Nmag_0717         CDS       T01176                                 

Definition
(GenBank) glycine cleavage system H protein
  KO
K02437  
glycine cleavage system H protein
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmag_0717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
716053..716439
Genome map
AA seq 128 aa AA seqDB search
MSFDIPDDRQYLESHEWALETDDDTVRVGITDFAQDELGDVVFVELPDEGDDLSQEAEFG
VIESIKAVSDLYAPVGGEVVAINEELFNAPELVNDDPFGDGWMLEIDPADTDELANLLSA
DEYEAQVA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgacattcccgacgaccgacaatatctcgaatcgcacgaatgggcactcgaa
accgacgacgataccgtccgcgtcggcatcaccgactttgcacaggacgaactcggcgac
gttgtcttcgtcgaacttcccgacgaaggggacgacctctcacaggaagccgagttcggc
gttatcgagtccatcaaggcagtctctgacctctatgcccccgtcggcggcgaggtcgtc
gccatcaacgaggagttgttcaatgcgccggaactcgtcaacgacgacccgttcggcgac
ggctggatgctcgagatcgatcccgccgacacggacgaactcgcgaatctgctctcggcc
gacgagtacgaagcccaggtcgcttaa

DBGET integrated database retrieval system