KEGG   Natrialba magadii: Nmag_0724Help
Entry
Nmag_0724         CDS       T01176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIRT CPP1-like
Motif
Other DBs
NCBI-ProteinID: ADD04309
UniProt: D3SZH5
Position
720202..720477
Genome map
AA seq 91 aa AA seqDB search
MLDALAEGVLMLMQLTVFALALGLTLISFQSYTKSQSKRLESAFIGFAFLSMGVALTTIT
SQLPSAATAFYIVETIPFIVGFGMLYVSLYR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcactcgcagaaggggtcctcatgctgatgcaactgaccgtctttgcactg
gcactcggactcaccctcatcagctttcaatcgtacacgaagagtcaatcgaaacgactc
gagtcggcgttcatcggcttcgccttcctcagtatgggcgttgccctgacgacgattacg
tcacagctcccatcggccgcaacggcgttctacatcgtcgaaacgataccgttcatcgtc
ggcttcggcatgctgtacgtctcgctgtaccggtag

DBGET integrated database retrieval system