KEGG   Natrialba magadii: Nmag_0729Help
Entry
Nmag_0729         CDS       T01176                                 

Definition
(GenBank) AAA ATPase central domain protein
  KO
K04800  
replication factor C large subunit
Organism
nmg  Natrialba magadii
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Nmag_0729
DNA replication proteins [BR:nmg03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     Nmag_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
722679..724223
Genome map
AA seq 514 aa AA seqDB search
MSDWTETYRPTTLSEVRGNNKARDKLKEWAETWDDHQDAVIVHGSPGVGKTSAAHALAND
LGWPVMELNASDSRGADVIERIAGEAAKSGTLTGGESGRRLVILDEADNFHGNADYGGSR
EVTRVVKSANQPIVLVANEFYDMSQSLRNACETIEFRDVSKRSIVPVLRDICRREDIEFE
DDALQKIAEDTSGDLRSAVNDLQAVAEEAERLTVDDVVTGDRDTTEGIFDFLDTLIKEED
AEGALKASYDVDENPDEMLNWIEDNVPKDYQGAELADAYEFLANADRWLGRVRSTQNYSF
WRYASDNMTAGVAASRREPKGGWTRYGPPSYWRKLGSSKGTRKTRDAIAERIAEREGTSV
GTARREIMPFLSAMTHHCKNRDLTVQMAAAYELDEKEVSFVTGSGKSTNKVQSIVEDAEE
LLTEQTVEHSGSAFFDTSDSDSDSTAATDAESLADDEASQAASDGQGQGQGQETLVSAGE
DGTGSSSEEPDDEPAETGSPDETDDDQSGLNDFF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactggaccgagacgtaccgcccgacgacgctgtcggaggtacgcgggaacaac
aaggcccgtgacaaactcaaagagtgggccgagacctgggacgaccatcaggacgcggtg
atcgtccacgggagccccggcgtcgggaagacctcggccgcccacgcgctggcgaacgat
ctgggatggcccgtgatggaactcaacgccagcgacagccgcggagccgacgtcatcgag
cgcatcgccggcgaggccgcaaagagcgggacactcaccggcggcgagtcgggccgacgg
ctggtcattctggacgaagcggacaacttccacggcaacgccgactacggcggctcacgg
gaggtcacccgcgtcgtcaagagcgcaaaccagccgatagtgctcgtggccaacgagttc
tacgacatgagccagagcctccgcaacgcctgcgagacgatcgagttccgcgacgtttcg
aagcgctcgatcgtccccgttttgcgggatatctgccgccgcgaggacatcgagttcgag
gacgacgccctgcagaagatcgccgaagacacgagcggcgaccttcgttccgcggtcaac
gacctccaggcagtcgccgaggaagccgagcgactgaccgtcgacgacgtggtgactggt
gaccgtgacacaacggaaggcatcttcgactttctggacacgctcatcaaggaagaagac
gccgaaggagcactcaaagcgtcctacgacgtcgacgagaatccagacgagatgctgaac
tggatcgaagataacgtccccaaggactaccagggtgctgaactggcggacgcctacgag
ttcctcgcgaacgccgaccgctggctgggtcgggttcgctcgacgcagaactactcgttc
tggcgctacgcctcggacaacatgactgccggcgtcgcggcctcccgccgcgagccgaaa
ggcggctggacccggtacggaccaccgagctactggcggaaactcggcagcagcaagggc
acgcgcaagacacgcgacgcaatcgccgagcggatcgccgagcgcgaggggacgagtgtc
gggaccgcccgccgagagatcatgccgttcctctcggcaatgactcaccactgcaagaat
cgggacctgaccgtgcaaatggccgcggcgtacgaactcgacgagaaggaggtctcgttc
gtgacgggaagtggaaagagcaccaacaaggtccagtcgattgttgaggacgccgaagag
ctgctcaccgagcagacggtcgaacactccggctctgcgttcttcgatacgtccgattcg
gacagcgattcaacagcggcgacggacgcggagtcgctggccgacgacgaggcgtcccag
gcagccagcgatggccagggacagggacaaggacaggaaacgctcgtctctgcgggtgaa
gacgggaccggttcgtccagcgaagaaccggatgacgaacctgccgaaacgggttcccca
gacgagaccgacgacgatcagtccggcctgaacgacttcttctga

DBGET integrated database retrieval system