KEGG   Natrialba magadii: Nmag_0731Help
Entry
Nmag_0731         CDS       T01176                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_0731
Enzymes [BR:nmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     Nmag_0731
Amino acid related enzymes [BR:nmg01007]
 Aminotransferase (transaminase)
  Class II
   Nmag_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(725216..726451)
Genome map
AA seq 411 aa AA seqDB search
MEDCDRGFDLEARLGSLEERAQKRTLSPVDRVAERGYFADAAGGDLPVLDTDEALVFSSN
NYLGLTDDQRVQDAARQAAATVGTGAGASRIITGDTMVHHDLERLLAETKGTERALAFSS
GYAANVGTITALEPDVIFSDERNHASLIDGCRLADCETIVYDHCDPASLRDALESRAAVA
DSTNADAGTEDESWLIVTDTVFSVDGTVAPLSAICDLAEEFGAWVMVDEAHATGLYADGG
GVVQAEGLEDRVHIQMGTLSKALASQGGYVAGSDALIESLLNEARSFAFSTGLAPTAAAA
ASEALHLARHSEAREQLWENVAHLRDGLETMGFSIPGESQILPVIVGDQRDALAFADGLR
ARGIVVPPIRPPAVPEGESRLRVAPIATHDRDDIITCLESFRTVGSELGLL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaagactgcgaccgcgggttcgacctcgaggcccggctgggatcactcgaggaacgc
gcgcaaaaacggacgctctcccccgtcgatcgggtcgccgagcgcgggtacttcgcagac
gccgccggcggtgacctgccggtgctcgacaccgatgaagcgctcgtcttctcctcgaac
aactacctcgggctgacagacgaccagcgggtgcaggacgcggcccgacaggccgccgcc
accgtcggtactggtgccggtgcgagccgtatcatcaccggcgataccatggtccaccac
gatctggagcgcctgctcgccgaaaccaagggtaccgagcgcgcgctcgcgttctcctcc
ggctacgccgcgaacgtcggcacgatcaccgcactcgagccggacgttattttctccgac
gaacgcaaccacgcgagcctcatcgacggctgccgactcgccgactgcgagaccatcgtc
tacgaccactgcgatccggcgagtctgcgcgatgcactcgagtcccgtgccgcagttgct
gacagcacgaatgcggacgcgggcaccgaagacgaatcctggctcatcgtcacggacacc
gtcttcagcgtcgacggcaccgtcgccccgctctcggcaatctgcgacctggccgaggag
ttcggcgcgtgggtaatggtcgacgaggcccacgcaaccggtctctacgcggacggcggc
ggcgtcgtgcaggcggaggggctcgaggaccgggttcacatccagatgggaacgctctcg
aaggcgctcgcgagccagggcggctacgtcgccggcagcgacgcgctcatcgagagtctg
ctcaacgaggcccgctcgttcgccttctcgaccggtctcgcaccgacggcggccgcggcc
gcgagcgaggcactccacctcgcacgccacagtgaggcgcgcgaacagctctgggagaac
gtcgcgcatcttcgggacggactcgagacgatgggattctcgatcccaggtgagtcccag
attctcccagtgattgtcggtgaccagcgagacgcgctcgcgttcgcggacgggcttcgc
gcccgcgggatcgtcgtcccgccgattcggccgcctgcggtgccggaaggcgagagtcga
ctccgcgtcgcgccgatcgcgactcacgaccgcgacgacattattacgtgtctggagtcg
ttccggacggtcggctctgaactcgggttgttgtag

DBGET integrated database retrieval system