KEGG   Natrialba magadii: Nmag_0737Help
Entry
Nmag_0737         CDS       T01176                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmg  Natrialba magadii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_0737
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmag_0737
   00640 Propanoate metabolism
    Nmag_0737
   00660 C5-Branched dibasic acid metabolism
    Nmag_0737
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmag_0737
Enzymes [BR:nmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nmag_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(731565..732722)
Genome map
AA seq 385 aa AA seqDB search
MAMKLHEYQAKQVFADAGVPTPSSQLASDVDGVLTAAEEIGYPVAVKAQVQVGGRGKAGG
IELVENDEEAREAAESIIGMDLKGYHVGQVLVEGAVDFTDELYVGITMDRGEGKPVAMVS
TKGGVNIEEVAEEDPDAIAREHIDPAFGMHPFQARKAVYDAGVDKSVANDVASVLTTLYD
LWESRDGSDAEINPLMVTADDEVIAADAVMNIDEDALFRQPELAEMEEEAASGGDELEQK
ADEYGFDYVRLEGNVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKAERIANALDM
VFSDDNVDSVVFNIFGGITRGDEVAKGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNE
DLVTVEQTLEDAVQRTVEYAEEVNE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaaactgcacgagtaccaggcgaagcaggtcttcgccgacgccggtgtcccc
acgccgtcgtcccaactcgcctctgacgtcgacggtgtactgaccgcggccgaggagatc
gggtatccagtcgcagtcaaggcgcaggtacaggtcggcggccgcggtaaggccggcggg
attgaactcgtcgagaacgatgaggaggcccgtgaggctgccgagtccatcatcggtatg
gacctcaagggctaccacgtcggacaggttctcgtcgagggagcggtcgacttcaccgac
gaactctacgtcggtatcacgatggaccgtggcgagggcaagcccgtcgccatggtctcg
acgaagggcggtgtcaacatcgaagaggtcgccgaggaggaccccgacgcgatcgcccgc
gagcacatcgaccccgcgttcggcatgcatccgttccaggcccgcaaggccgtctacgac
gccggtgtcgacaagagcgtcgccaacgacgtcgcaagtgttctcaccacactctacgat
ctctgggagagccgcgacggctccgacgccgagattaacccgctgatggtcacggctgac
gatgaggtcatcgcagccgacgccgtcatgaacatcgacgaagacgccctcttccgccag
cccgagttagcggaaatggaagaagaagccgcaagcggcggcgacgaactcgagcagaag
gcagacgagtacggcttcgattacgtccgactcgagggcaacgtcggtatcatcggcaac
ggagccggtctcgtcatgaccacgctcgacctcgtcgactactacggcggcgaacccgcc
aacttcctcgacgttggtggtggcgcgaaggcagaacgcatcgcgaacgcgctggacatg
gtcttctccgacgataacgtcgacagcgtcgtcttcaatatcttcggtggcatcacccgc
ggcgacgaggtcgccaagggaatcaacgaggcactcgagcagttcgacgaaatccccaag
ccggtcgtcgtccgtctcgccggcactaactgggaggaaggcatggagattctgaacgaa
gacctcgtgactgtcgaacagacactcgaggacgcggtccagcgtaccgtcgagtacgcg
gaggaggtgaacgaataa

DBGET integrated database retrieval system