KEGG   Natrialba magadii: Nmag_0809Help
Entry
Nmag_0809         CDS       T01176                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nmg  Natrialba magadii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_0809
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nmag_0809
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Nmag_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818911..819966
Genome map
AA seq 351 aa AA seqDB search
MSDEADTDSGPSSNQDADRTARLLGVPLDLGANRRGVDMGPSAIRYADVAAELAAAGVDC
IDDGDLEVPRLETSSPAPASGVNDSDSNTNTNSNSNTNTNTNSNSNSNSNTNAKYLDDIG
GVTATLADAVAATVDDDTTPLVLGGDHAVAMGSMFGSGRGTDNGIGVIWFDAHGDYNTPA
TSPSGNVHGMPLAAAHGRGSFADLDWADTDAVSEENTVLVGIRSLDDEERAALRESEATV
FTMREIDERGITAVVEDALEIATDGVDGIHVSLDLDWLDPTVVPGVGTPVRGGVNYREAH
AALELVAERDREADILRSMDVVEVNPILDRDNQTAEVAAELAASAFGKRIL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaggccgacacggactcaggaccgagcagcaatcaggacgcagaccgcacc
gcacgactgctcggcgtgccactcgaccttggtgcgaaccgccgtggcgtcgacatgggt
ccctcggcaatccgctacgccgacgttgccgccgaactcgccgccgccggtgtcgactgc
atcgatgacggtgacctcgaggtcccgcgactcgagacgagttcacccgcacctgcgtcc
ggtgtgaacgactcagactcgaacacgaacacgaactcgaactcgaacacgaacacgaac
acgaactcgaactcgaactcgaactcgaatacgaacgcaaagtacctcgacgacattggc
ggcgtaacggcgacgcttgcggatgccgtcgccgcgacggtcgacgacgacacgacaccg
ctcgtcctcggcggcgaccacgcagtcgccatggggtcgatgttcggttccggccgtggc
accgacaacggaatcggcgtcatctggttcgacgcccacggcgactacaacacgcccgcg
acatccccgagcggcaacgttcacggcatgccgctcgccgccgcccacggccgcggctcg
ttcgccgatctcgactgggccgacacggacgccgtcagtgaggaaaacaccgtccttgtc
gggatccgaagcctcgatgacgaggaacgagcagcactgcgtgagagcgaggccaccgtc
tttaccatgcgcgaaatcgacgaacgcggtatcaccgccgtcgtcgaagacgcactcgaa
atcgccaccgacggcgtcgacgggattcacgtgagcctggatctggactggctcgatccg
acggtcgttccaggcgtcggcacccctgtccgcggcggtgtcaactaccgcgaagcccac
gccgcactcgagttagtcgccgagcgcgaccgggaggcagacatcctgcggtcgatggac
gtagtcgaggtaaatccgatcctcgaccgagataaccagacggcggaggttgcagcggaa
cttgcggccagtgcgttcgggaagcgcattttgtag

DBGET integrated database retrieval system