KEGG   Natrialba magadii: Nmag_0830Help
Entry
Nmag_0830         CDS       T01176                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_0830
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_0830
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nmag_0830
Enzymes [BR:nmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nmag_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841596..842897
Genome map
AA seq 433 aa AA seqDB search
MTASSQARLRCYDCGCTYDHGDRTRCSCGEPLWFDLDVDEFEWPTETAQATEQDPATTGI
WRYDAVLPVSAPETTTLPPGSTPLVRAGALDSFAGCELHLKPEGQNPTGSFKDRGTAVGV
AHALDTDTDWIGTVSHGNMALSTSAYAAAAGLECTVFVPADIPPERLDLLARHDPHIFRV
EGEYGRLYEETLALDTDGDAGITFVNSDTPLRVAGQKTIAYELLEQFRLESPNAPSSPGV
PSSSTASTASTAPDAIVLPVSSGGQASGVWKALRELTRSGVLAADDVPRLYFVQAAPCDP
IATAFREGREEVMPIDADETIAVSIANSDPPSGTRALTAARDTDGAVVAVPDEATREAMD
RLATDAGLAVEPSSAVALAGVRELSDRGEIAADELVVTILTGSGYKESVETEPRSRHIDL
ADLEHELASVVES
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgagttcgcaggcccgactccgatgttacgactgtggctgcacgtatgaccac
ggcgaccgcacgcgatgttcctgcggggaaccgctctggttcgatctcgatgtggacgaa
ttcgagtggcccacagagacagcccaagcaacggaacaagatccggcgacgaccggtatc
tggcgctacgacgccgtcctcccggtttccgcacccgagacgactacactgccgcccggt
tcgacaccgctcgtccgcgcaggtgcactggactcgttcgccggctgcgagctacacctc
aagccagagggacagaaccccaccggcagcttcaaagaccgcggcaccgccgtcggcgtc
gcccacgccctcgacaccgacacagactggatcggcaccgtctcccacgggaacatggcc
ctgagcaccagcgcctacgccgcggcggccggactcgagtgcaccgtcttcgtcccggcg
gatattccgccggaacggctcgatttgctcgctcggcacgatccgcatatcttccgcgtc
gagggagagtatggcaggctctacgaggagacgctcgcgctcgatactgacggcgacgcc
ggtatcacgttcgtcaactccgatacgccgctgcgggtggccggccagaagacgattgcg
tacgagttactcgagcagtttcgactggagtccccgaacgcgccgtcttcgccgggcgtg
ccgtcctcgtcgacggcgtcgaccgcgtcgaccgcaccggacgcgatcgtcctcccggtc
agcagcggcggccaggccagcggcgtctggaaagcactccgagaactgacccggagtggc
gtgctcgcagccgacgacgttccgcggctctacttcgtgcaggcagcgccgtgcgatcca
atcgcgacggccttccgggagggccgcgaggaggtaatgccgatcgacgccgatgagacg
attgctgtctccatcgcgaacagcgacccgccgagtggcacccgcgcgctcacggccgct
cgcgataccgatggcgcggtcgttgccgtccccgacgaggccacgcgcgaggcgatggac
cggctggcgacggacgccggtctcgccgtcgagccgtccagcgcagtcgcgctcgcggga
gttcgagagctctcggaccgcggcgagatcgcagcagacgagttggtcgttacgattcta
accggctccgggtacaaggagtcagtcgagacggagccgcgaagccgccacatcgacctc
gcggacctcgaacacgaactcgcgtctgtcgtcgagtcctga

DBGET integrated database retrieval system