KEGG   Natrialba magadii: Nmag_0837Help
Entry
Nmag_0837         CDS       T01176                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nmg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nmg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nmg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849332..851020
Genome map
AA seq 562 aa AA seqDB search
MSWTVMPTFDDYDRAREEFEWDLPDDFNPAVDFLRKHDDTSRVALRYERPGESDKEDGNG
DSETHSTEDTIETYTFDDLDDRSDRLAAALADLGVEAGDRVGVVVPQKPQNPITHLANWK
LGAVSVPLTVLFGRDALQYRLEDSEATAVVVDPSVRGTIEEIRDECPALESVIELGTADS
VDGDAYAFDELLASHEPGIEVYDATPETPSAIMYTSGSTGPPKGVLHSHALWLGRAAAAY
NYFEQGLAEGEATLWTPADWAWGAALGGTLFAAWHHGCTIVGWPREGFDPEAAYDLMERH
GVTKAFMPPTALRMLMGVDDPEGQFDLALETFASAGEPLTPEVVDWVQETFANVGINDFY
GQTELNLVVGNSSWFETRPGSMGKPFPGYEVAILDPDSEERVPEGEVGELAVKPDDRRVF
FNEYWGFPEKTAAKQTESGWFRTGDLVERDDEGYLWFVSRTDDVILTSGYRVGPMEVEEA
ILHHDAVEQVGVVGVPDETRGEAIKAFVQPATAVADAAKLREEIRTLVRERLAEYEYPQE
IEFVDELPTTTTGKIRRRSLRD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagttggacggtgatgccgacgttcgacgactacgaccgtgctcgcgaggagttcgag
tgggacctcccagacgactttaacccggctgtcgacttccttcgcaaacacgacgataca
agccgtgtcgcactccgatacgagcgacccggcgaaagcgacaaggaagatggaaacggc
gacagcgaaacgcactccaccgaggacaccatcgagacgtacacgttcgacgacctcgac
gaccgttcggaccggctcgccgccgcactcgccgacctcggcgtcgaggccggcgatcgc
gtgggcgtcgtcgtcccgcagaaaccccagaacccgatcacccacctcgcaaactggaaa
ctcggcgcggtgtcagtgccgcttaccgttctctttggccgggacgcactccagtaccgc
ctcgaggacagcgaggccaccgccgtcgtcgtcgatccgagcgtccgcggaaccatcgag
gaaattcgtgacgagtgtcccgcactcgagtccgtgatcgaactcggcaccgccgactcg
gtcgacggcgatgcgtacgccttcgacgagttgctcgcttcgcacgagccagggatcgag
gtctacgatgcgacgccggagacgccgtcagcgattatgtacacgagcgggtcgacgggg
ccgccgaagggtgtcctccacagtcacgcgctgtggctcggccgtgctgcggcggcgtac
aactatttcgagcaggggctcgcggagggcgaggcgacgctgtggacgcccgcggactgg
gcctggggcgctgcactcggcgggacgctcttcgccgcgtggcaccacggctgtacgatc
gtcggctggccgcgggaggggttcgaccccgaggcggcttacgacctcatggaacgccac
ggggtaaccaaggcgttcatgccaccgaccgcgctccggatgctgatgggcgtcgacgat
cccgaggggcagttcgatcttgcactcgagacgttcgcctcagcgggtgagccgctgact
ccggaggtggtcgactgggtgcaggagacgttcgccaatgtggggatcaacgacttctac
gggcagacggagctcaatctggtcgtcggcaactcctcgtggttcgagacgcggccgggg
agtatgggcaagccgttcccgggctacgaggtggcgattctcgatcctgattccgaggaa
cgggtgccggagggcgaggtgggcgagttagccgtcaagccggacgatcggcgggttttc
ttcaacgagtactgggggtttccggagaagacggcagccaagcagacggagagcggctgg
ttccggacgggcgacctcgtcgaacgtgacgacgagggctacctgtggttcgtctcgcgg
accgacgacgtgatcctcaccagcggctaccgtgtcggtccgatggaagtcgaggaggca
atcctccaccatgacgccgtcgaacaggtcggcgtcgtcggcgtcccggacgaaacccgc
ggcgaggcgatcaaagcattcgtccagcctgccactgcggtggcggatgcggcgaaactc
cgcgaagaaatccgcaccctcgtccgcgagcgcctcgcggagtacgaatacccacaggag
atcgaattcgtcgacgaacttccgaccaccacgaccggcaagatccggcggcggtcgctt
cgcgactag

DBGET integrated database retrieval system