KEGG   Natrialba magadii: Nmag_0837Help
Entry
Nmag_0837         CDS       T01176                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_0837
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_0837
   00620 Pyruvate metabolism
    Nmag_0837
   00640 Propanoate metabolism
    Nmag_0837
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmag_0837
   00680 Methane metabolism
    Nmag_0837
Enzymes [BR:nmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nmag_0837
Lipid biosynthesis proteins [BR:nmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nmag_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849332..851020
Genome map
AA seq 562 aa AA seqDB search
MSWTVMPTFDDYDRAREEFEWDLPDDFNPAVDFLRKHDDTSRVALRYERPGESDKEDGNG
DSETHSTEDTIETYTFDDLDDRSDRLAAALADLGVEAGDRVGVVVPQKPQNPITHLANWK
LGAVSVPLTVLFGRDALQYRLEDSEATAVVVDPSVRGTIEEIRDECPALESVIELGTADS
VDGDAYAFDELLASHEPGIEVYDATPETPSAIMYTSGSTGPPKGVLHSHALWLGRAAAAY
NYFEQGLAEGEATLWTPADWAWGAALGGTLFAAWHHGCTIVGWPREGFDPEAAYDLMERH
GVTKAFMPPTALRMLMGVDDPEGQFDLALETFASAGEPLTPEVVDWVQETFANVGINDFY
GQTELNLVVGNSSWFETRPGSMGKPFPGYEVAILDPDSEERVPEGEVGELAVKPDDRRVF
FNEYWGFPEKTAAKQTESGWFRTGDLVERDDEGYLWFVSRTDDVILTSGYRVGPMEVEEA
ILHHDAVEQVGVVGVPDETRGEAIKAFVQPATAVADAAKLREEIRTLVRERLAEYEYPQE
IEFVDELPTTTTGKIRRRSLRD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagttggacggtgatgccgacgttcgacgactacgaccgtgctcgcgaggagttcgag
tgggacctcccagacgactttaacccggctgtcgacttccttcgcaaacacgacgataca
agccgtgtcgcactccgatacgagcgacccggcgaaagcgacaaggaagatggaaacggc
gacagcgaaacgcactccaccgaggacaccatcgagacgtacacgttcgacgacctcgac
gaccgttcggaccggctcgccgccgcactcgccgacctcggcgtcgaggccggcgatcgc
gtgggcgtcgtcgtcccgcagaaaccccagaacccgatcacccacctcgcaaactggaaa
ctcggcgcggtgtcagtgccgcttaccgttctctttggccgggacgcactccagtaccgc
ctcgaggacagcgaggccaccgccgtcgtcgtcgatccgagcgtccgcggaaccatcgag
gaaattcgtgacgagtgtcccgcactcgagtccgtgatcgaactcggcaccgccgactcg
gtcgacggcgatgcgtacgccttcgacgagttgctcgcttcgcacgagccagggatcgag
gtctacgatgcgacgccggagacgccgtcagcgattatgtacacgagcgggtcgacgggg
ccgccgaagggtgtcctccacagtcacgcgctgtggctcggccgtgctgcggcggcgtac
aactatttcgagcaggggctcgcggagggcgaggcgacgctgtggacgcccgcggactgg
gcctggggcgctgcactcggcgggacgctcttcgccgcgtggcaccacggctgtacgatc
gtcggctggccgcgggaggggttcgaccccgaggcggcttacgacctcatggaacgccac
ggggtaaccaaggcgttcatgccaccgaccgcgctccggatgctgatgggcgtcgacgat
cccgaggggcagttcgatcttgcactcgagacgttcgcctcagcgggtgagccgctgact
ccggaggtggtcgactgggtgcaggagacgttcgccaatgtggggatcaacgacttctac
gggcagacggagctcaatctggtcgtcggcaactcctcgtggttcgagacgcggccgggg
agtatgggcaagccgttcccgggctacgaggtggcgattctcgatcctgattccgaggaa
cgggtgccggagggcgaggtgggcgagttagccgtcaagccggacgatcggcgggttttc
ttcaacgagtactgggggtttccggagaagacggcagccaagcagacggagagcggctgg
ttccggacgggcgacctcgtcgaacgtgacgacgagggctacctgtggttcgtctcgcgg
accgacgacgtgatcctcaccagcggctaccgtgtcggtccgatggaagtcgaggaggca
atcctccaccatgacgccgtcgaacaggtcggcgtcgtcggcgtcccggacgaaacccgc
ggcgaggcgatcaaagcattcgtccagcctgccactgcggtggcggatgcggcgaaactc
cgcgaagaaatccgcaccctcgtccgcgagcgcctcgcggagtacgaatacccacaggag
atcgaattcgtcgacgaacttccgaccaccacgaccggcaagatccggcggcggtcgctt
cgcgactag

DBGET integrated database retrieval system