KEGG   Natrialba magadii: Nmag_0872Help
Entry
Nmag_0872         CDS       T01176                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
nmg  Natrialba magadii
Brite
Enzymes [BR:nmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Nmag_0872
Transfer RNA biogenesis [BR:nmg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Nmag_0872
Chromosome and associated proteins [BR:nmg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Nmag_0872
   HAT complexes
    Elongator complex
     Nmag_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ADD04456
UniProt: D3T098
Position
complement(888507..890177)
Genome map
AA seq 556 aa AA seqDB search
MSTETPDSDDPTETKAFRRVCETLVDRILAGEIERDEVEKAKLEACSEHSAPKVPKNSEL
LDYAPQEHREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQS
YTGNEPAAARGVQNDYDPYGQVTLRLEQLREIGHPIDKVELILMGGTMTARSHDYQEWFV
KRALEAMNDYDVDKEPEPAEGISFAEDPEEYEFKYLEDVIAENETGDVRNIGTTFETKPD
WCDPEQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGAQASIDANQRLRDSAFKVGFHM
MPGQPGMSKEMCLEDFRRIFEEEQWKPDYLKIYPTLIVRGTATYDWWHKGEYDPLDNDEA
ADLVAEIKDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMDEHDWTCECIRCRE
VGMNDAEPNEVELDVMTYDACGGTEHFISFEDFEQDLLIGFCRLRFPHDPVRPELENTAL
IRELHVYGSEVTMGEEGESGQHQHQGYGRRLMEQAEELAADAGYDKVSVISGIGAREYYR
NKLGYHQDGPYVSKRL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgattccgacgatccaaccgagacgaaagccttccgacgggtc
tgtgagacgctcgtcgaccggatcctcgcgggcgaaatcgagcgcgacgaggtcgagaag
gccaaactcgaggcctgttcggagcactccgcgccgaaggtgccgaagaactcggagctg
cttgattatgcgccacaggaacaccgtgaggatctggaagcggtgctccagcgcaagccc
gtccgcaccgcctcgggtgtctcaccggttgcgatcatgacctcgcccgagcggtgtcct
cacgggaagtgtctctactgtcccggcggccccgactcggagttttcctcctcccagagc
tacaccggaaacgaacccgccgccgcccgcggcgtccagaacgactacgacccgtacggc
caggtgacgctgcgactcgagcagctccgggagatcggtcacccgatcgacaaggtcgaa
ctcatcctgatgggtgggacgatgaccgcccggagccacgactaccaggagtggttcgtc
aagcgcgccctggaggcgatgaacgactacgacgtcgacaaggagcccgagccggcggag
ggcatcagcttcgcagaggaccccgaggagtacgagttcaaatatctcgaagacgtgatc
gcggagaacgagaccggagacgtccgtaacatcggcacgacgttcgagaccaagcccgac
tggtgtgaccccgagcagatcgaccggatgctcgacctcggtggcacgaaagtcgaggtc
ggggtccagaccacctacgagcggatcaatcgggagatgcaccgcggccacggcgcgcag
gcgtcgatcgacgccaaccagcgactccgtgactcggcgttcaaggtcggcttccacatg
atgcccggccagccagggatgagcaaggagatgtgtctcgaagacttccggcgcatcttc
gaagaagagcagtggaagcccgactacctgaagatttacccgacgctcatcgtccgcggc
accgcaacgtacgactggtggcacaagggcgagtacgatcccctcgacaacgacgaagcc
gccgacctggtcgctgaaatcaaggacatgattccgcgctacacgcgcctccagcgggtc
cagcgcgacattccggcggacttcatcgacgccggcgtctggaagtcgaacctccgccag
ctcgcgcgcaagcgcatggacgaacacgactggacttgcgagtgcatccgctgtcgcgag
gtcgggatgaacgacgccgaaccgaacgaggtcgaactcgacgtcatgacctacgacgct
tgcggcggcacggaacacttcatttccttcgaggacttcgagcaggacctcctgatcggc
ttctgccgactccggtttccgcacgatcctgtgcgaccggaactcgagaacaccgcgctc
attcgcgaacttcacgtctacgggtctgaggttacgatgggcgaggagggcgagtcagga
cagcaccagcatcagggctacggccgccgcctgatggagcaagcagaggagctcgcagcc
gacgcaggctacgacaaggttagcgtcatctcgggtatcggcgcgcgggagtactaccgg
aacaagctcggctatcatcaggacgggccgtacgtgagcaagcggctctaa

DBGET integrated database retrieval system