KEGG   Natrialba magadii: Nmag_1068Help
Entry
Nmag_1068         CDS       T01176                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_1068
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_1068
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nmag_1068
Enzymes [BR:nmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nmag_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089892..1091217
Genome map
AA seq 441 aa AA seqDB search
MTNEADPDPDPSAESESESESESDPELDAESVAETEPQTKPSVETTSTFTGLECYDCGET
FNADEVTHRCPDCDGILDPTYDYDAIGAELDRETLESRSFDSMWRYEELLPFTRDSAVTM
DEGATPLVDCPKLAEEMGVGRVLIKDEGRNPTGTFKDRGQTLAVTAAVRHGASEVALASA
GNAGQSAAAYAGRAGLESNVYLPARSGFTNKAMVNVHGGDMNVVGGRIGDAGAAFEEGLA
EHDEWYPLQTFVTPYRHEGKKTMFYELVEQLEWEVPDAICYPTGGGVGLVGMYKAAQEYV
DLGLTDELPGFYAAQSAGCAPIVDAFDEGKDVHDPVETPDTICGGIEIPDPGASPWVLEA
LRESEGGAVATDDTEILDAAIQVAQHEGIEMAPTCAAAASGAWALAERGEFDGDETVVIL
NTGTGNKDADVLRSHLMSQGI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaggcggacccggacccggacccgagcgcagagtcagaatcggaatcggaa
tcagaatcagacccagagttggatgcggagtcagttgccgaaacggaaccacagaccaaa
ccctcggtcgaaaccaccagcaccttcaccggactcgagtgctacgactgtggcgaaacg
ttcaatgccgacgaggtgacgcatcgttgtcccgactgtgacggcattctcgatcccacc
tacgactacgacgcgatcggcgcggaactcgaccgcgagacgctcgaatcgcgatcgttc
gactccatgtggcgctacgaggagctgctgccgttcactcgcgactcggccgtcacgatg
gacgagggcgcgaccccgctcgtcgactgtcccaaactggccgaggagatgggcgtcggg
cgcgtcctgatcaaggacgaaggccggaacccgacgggcaccttcaaggaccgcggacag
acgctcgccgtcacggccgcagtgcgccacggcgcaagcgaggtcgccctcgcctccgct
ggcaacgccgggcagtccgccgccgcctacgccggtcgcgccggcctcgaatcgaacgtc
tacctccccgcgcgctctggctttaccaacaaggcgatggtcaacgtccacggcggcgac
atgaacgtcgtcggcggtcggatcggcgacgccggcgcggccttcgaggaagggctcgcg
gagcacgacgagtggtatccgctccagacgttcgtcacgccctaccgccacgagggcaag
aagacgatgttctacgaactcgtcgagcaactcgagtgggaagttccggacgcgatctgt
tatccgaccggcggcggcgttggcttggtcgggatgtacaaggcggcccaggagtacgtc
gacctcggactcaccgacgaactgccgggcttctacgcggcccaatcggcgggctgtgcg
ccaatcgtcgacgccttcgacgaggggaaggatgtccacgacccggtcgagacaccggac
acgatctgcggcgggatcgagatcccggaccccggcgcgagcccgtgggtactcgaggcg
ctgcgcgagagcgagggcggtgcggtggcgacggatgacaccgagattctcgacgcggcg
atccaggtagcccagcacgaggggatcgagatggctccgacctgcgcggccgcagccagc
ggcgcgtgggcgctcgcagagcgcggcgagttcgacggcgacgagacggtcgtcatcctg
aatacggggacggggaacaaggacgcggacgtgttgcgaagtcacctgatgagtcaggga
atatag

DBGET integrated database retrieval system