KEGG   Natrialba magadii: Nmag_1259Help
Entry
Nmag_1259         CDS       T01176                                 

Definition
histidine biosynthesis protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_1259
   01230 Biosynthesis of amino acids
    Nmag_1259
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_1259
   00051 Fructose and mannose metabolism
    Nmag_1259
   00562 Inositol phosphate metabolism
    Nmag_1259
Enzymes [BR:nmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmag_1259
Exosome [BR:nmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmag_1259
  Exosomal proteins of bladder cancer cells
   Nmag_1259
  Exosomal proteins of melanoma cells
   Nmag_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1289526..1290239)
Genome map
AA seq 237 aa AA seqDB search
MSELEYPFFLVNTKTNPEVVGDDLREFAATVERVADDTERRFALAPQVPDIRLVASETTL
PIVAQTAVRHEDASIGDATCEAVAAAGADAVFVNHPENEDTFGTVGRLIERCDALGLESI
VCVPDHQTAAAALAFDPAPDCLLFEQPADIASEGGMVRSDPEGLESFVEFVAAESSKTRV
FVGGGIRTAEDVEQAFDCGVDATGAASAALEAAAGDDFEAWLRAVAAVMPPAGDSNT
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactcgagtaccccttctttctggtcaacaccaagaccaaccccgaggtcgtc
ggcgacgaccttcgtgagttcgcggcgacggtcgaacgcgtcgcagacgacaccgagcgc
cggttcgcgctcgcgccacaggttcctgatatacgcctcgtcgcgtcggagaccacgctt
ccgatcgttgcccagaccgctgtccgtcacgaagatgcgagtatcggcgacgcgacctgc
gaggcggtcgccgctgccggcgctgacgctgtcttcgtcaatcaccctgagaacgaggac
acctttgggaccgttggccgactcatcgagcgctgcgacgcgctcggactggaatcgatc
gtctgcgtcccggaccaccagactgccgcggcggcgctcgcgttcgaccccgcgccggac
tgcctgctgttcgaacagcccgcggacatcgcctccgagggtggcatggtgcgatcggat
ccggagggactcgagtcgttcgtcgagttcgtcgccgccgaatcgtcgaaaaccagggtc
ttcgtcggcggcggcattcgaaccgctgaggacgtggagcaggcgttcgactgcggcgtc
gacgcgaccggcgcggcctcggccgcgctggaagccgctgctggcgacgattttgaggcg
tggcttcgagcagttgcagcggtgatgccgccggccggcgactcgaatacgtga

DBGET integrated database retrieval system