KEGG   Natrialba magadii: Nmag_1740Help
Entry
Nmag_1740         CDS       T01176                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmg  Natrialba magadii
Pathway
nmg00010  Glycolysis / Gluconeogenesis
nmg00030  Pentose phosphate pathway
nmg00051  Fructose and mannose metabolism
nmg00052  Galactose metabolism
nmg00230  Purine metabolism
nmg00500  Starch and sucrose metabolism
nmg00520  Amino sugar and nucleotide sugar metabolism
nmg00521  Streptomycin biosynthesis
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_1740
   00030 Pentose phosphate pathway
    Nmag_1740
   00051 Fructose and mannose metabolism
    Nmag_1740
   00052 Galactose metabolism
    Nmag_1740
   00500 Starch and sucrose metabolism
    Nmag_1740
   00520 Amino sugar and nucleotide sugar metabolism
    Nmag_1740
  Nucleotide metabolism
   00230 Purine metabolism
    Nmag_1740
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmag_1740
Enzymes [BR:nmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nmag_1740
    5.4.2.8  phosphomannomutase
     Nmag_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADD05314
UniProt: D3SUQ6
Position
complement(1772934..1774298)
Genome map
AA seq 454 aa AA seqDB search
MEVFGSSGTRGVANEELTPAFVLRVAKAAGTAWQVDRVAIARDTRYTGRMLADAAASGLT
STGTDVDRLGIVPTPGAQGYAEREGVPVIVITASHNPPQYNGIKLVGSDGVELAVTDLEA
VEETLLAGEFAVSPWDETGRVRDIDGARDAYIDELLAASNREAISDADLTVALDPGHGAG
TLTSPEFFRELGCRVRTVNSQPDGKFPGRDPEPVPDNLGDLGRLVRTTDADIGIAHDGDA
DRAIFFDENGEFVSGDAALAALAAAQLESGETTVSAVNVSQRLVDVVTNVGADLELTPIG
STNIITRIEELEANGEHVPIAGEGNGGIFFPDYRLSRDGAYTAARFLELVAEQPVSEIVA
PYDGYANIRRNIKYESTAERDAMLDAAANHAHAADAELNTRDGYRLDYGDAWVLARPSGT
EPLVRVYAEARDADRATELVEEMYETLAEAKADS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcttcggatcgagcgggacacgtggcgtcgccaacgaggagctgacgccggcg
ttcgtcctgcgggttgccaaagcggcgggcacggcctggcaggtggaccgggtcgcaatt
gctcgcgacacccgctacacgggacggatgctggccgatgcggcagcgagcggactgacg
agtacgggcaccgacgtcgaccgattgggaatcgttccgacgccgggcgcgcaggggtac
gccgaacgcgagggcgtccccgtcatcgtcatcaccgcctcgcacaatccgccccagtac
aacggcatcaaactcgtcggcagcgacggcgtcgaactcgccgttactgacctcgaagcc
gtcgaggagacgctgctcgcgggcgagttcgccgtctccccgtgggacgagactggccga
gtccgtgacatcgacggcgctcgcgacgcatacatcgacgagttgctcgccgcctcgaac
cgcgaggcgatctccgatgccgacctgacggtcgcactcgaccccggccacggcgcaggg
acgctcaccagccccgagttcttccgcgaactcggctgtcgcgtccgcacggtcaacagc
cagcctgacggcaagttccccggccgggaccccgaaccagttcccgacaacctcggcgat
ctgggccgcctcgtccggacgaccgacgccgatatcggcatcgcccacgacggcgacgcc
gaccgcgctatcttcttcgacgagaacggcgagttcgtctccggcgacgcagcgctggcc
gccctcgctgcggcccaactcgagtccggcgagacgacggtgtctgcggtcaacgtctcc
cagcggctcgtcgacgtcgtgaccaacgtcggtgccgacctcgaactcacgccgatcggg
tcgacgaacatcatcacacggatcgaggaactcgaggccaacggtgaacacgtcccgatc
gcgggcgagggcaacggcggcatcttcttccctgattaccgactctcgcgcgacggggcc
tacacagcagcccggttcctcgagttggtcgccgaacagccggtgagcgaaatcgtcgca
ccgtacgacgggtatgcgaacattcggcgcaatatcaagtatgagtcgacggccgaacgc
gacgcgatgctcgatgcggcggcgaatcacgcccacgcggcggatgcggagttgaatacg
cgcgacggctatcgtctcgattacggtgatgcctgggtgttggctcgcccgtccggcact
gaaccgctcgttcgggtctatgcggaagcgcgtgacgcggaccgggcgaccgaactggtc
gaggagatgtacgagacgctcgccgaggcgaaggcagactcctga

DBGET integrated database retrieval system