KEGG   Natrialba magadii: Nmag_1755Help
Entry
Nmag_1755         CDS       T01176                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_1755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_1755
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nmag_1755
Enzymes [BR:nmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nmag_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1787880..1789148)
Genome map
AA seq 422 aa AA seqDB search
MSLSLSADQPAAPADAEDGVWLECIECGETFAPFADVRYTCDECDGLLEVRYDDLPTFED
FAAAADPDQGVWRYADALPLPSGVSIQEGATPLYDVPSLEADLGLEALRIKHEGMNPTGS
FKDRGMTVGVAVARELGVDRLACASTGNTSAALAAYGSRGGMETLVLLPAGKVAAGKVAQ
ASLHGARILEVDGNFDACLDIVQELAGQGEAYLLNSLNPFRLEGQKTIGLEILEGFLADY
DTVPDRIVLPVGNAGNTSALYKAFRELVQAGALEEDEVPKLVGVQAEGAAPMVEAIENGA
DEVRRWDDVETRATAIRIGNPVNAPKALPGIRETGGTAISVTDEEITDAQRDLAGEGIGV
EPASAASVAGLRKLREEGIVTEDERVACLTTGHLLKDPDAAAAAGREPEPVPAETAGVLD
HL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcagtctctctgccgaccagccggcagcgcccgccgacgccgaggacggtgtc
tggctcgagtgcatcgagtgcggcgagacgttcgcgccgttcgcggacgtccgctacacc
tgcgacgagtgcgacggcctgctcgaggtgcgctacgacgacctgccgaccttcgaggac
ttcgcggccgccgcggaccccgaccagggcgtctggcgctacgccgacgcgctcccgctc
ccgtcgggcgtctcgatccaggagggtgcgacgccgctgtacgacgttcccagtctggaa
gccgatctaggactcgaggcgctgcggatcaaacacgaggggatgaacccgacgggatcg
ttcaaggaccgcggcatgaccgtcggcgtcgccgtcgcgagggaactcggcgtcgaccga
ctcgcctgcgcctcgacgggcaacacgagcgccgcgcttgcagcctacggctcccgcggc
gggatggagacgctggtgctcctccccgcgggaaaggtcgccgccggaaaggtcgcccag
gcgagcctccacggcgcacgcattctggaggtcgacggcaacttcgacgcctgtctcgac
atcgtccaggagttagccgggcagggcgaggcctacctgctgaactcgctgaacccgttc
cgactcgagggccagaagaccatcggcctcgagattctggagggcttcctcgcggactac
gacacggttccggaccggatcgtgctcccggtcggcaacgccggcaacacgtcggcgctg
tacaaggccttccgcgaactcgtgcaggcgggggcactcgaggaggacgaggttccgaaa
ctggtcggcgtgcaagccgagggcgcggctccgatggtcgaagcgatcgagaacggcgcg
gacgaagttcgccgctgggacgacgtagagacgcgcgcgacggcgatccgaatcgggaac
ccggtcaacgcgccgaaggcgttgccggggatccgcgaaactggtggcaccgcgatttcg
gttaccgacgaggaaattaccgacgcccagcgcgacctcgcaggcgaggggatcggcgtc
gagccggcctctgcagcctccgtcgcgggcctccgaaagcttcgcgaggaggggatcgtc
accgaagacgaacgcgtcgcttgcctgacgacgggccacctgctcaaggaccccgacgcg
gcggccgctgcgggtcgcgagccagagccggtgccggccgagactgcgggcgttctcgac
cacctctga

DBGET integrated database retrieval system