KEGG   Natrialba magadii: Nmag_2146Help
Entry
Nmag_2146         CDS       T01176                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmg  Natrialba magadii
Brite
Enzymes [BR:nmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nmag_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2191024..2191770
Genome map
AA seq 248 aa AA seqDB search
MDPAVLREDMVDGLESPAKDVLQNETVAVAMRDVPRHEFVDDERTAYADRDHEVLGTRML
SPSTVARFMDALAPTAGDDVLVVGAGVGYTAALAAEIAGETNVHAIDIARPLVIEARQNL
ASAGYDGVLVDRRDGAEGLPEYAPFDCILLEAAVVSPPRALLDQLAPEGRLVYPEGTQRQ
RVVAVTEGGDRTEHDVVSLEPLLVEGEQQGTIERNRMAREDREYAQRRAESRRGWEQDWI
EWERSVDS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcggtactgcgagaggacatggtcgacggactcgagtcccccgccaaggac
gtccttcagaacgagaccgtcgccgttgcgatgcgggacgtgccacgccacgagttcgtc
gatgacgagcggacggcgtacgccgaccgcgaccacgaggtgctcgggacgcgtatgctc
tcgccgagcactgtcgctcgattcatggacgccctcgcaccgacagccggtgatgacgta
ctcgtcgtcggtgccggcgtcggctacaccgctgcgcttgccgccgagatcgccggcgag
acgaacgtccacgcgatcgacatcgctcgcccactcgtcatcgaagcccggcagaacctc
gccagcgcgggctacgacggcgttctcgtcgaccgccgcgacggagccgaggggctcccc
gagtacgctccgttcgattgcattctgctggaggccgccgtcgtgtcaccgccgcgggcg
ttactcgaccagctggctccagaggggagactggtctacccggaggggacccagcgccag
cgcgtggtcgcggtcaccgaaggcggtgaccggaccgaacacgatgttgtctctctggag
ccgttactggtcgagggtgaacagcagggaaccatcgaacggaatcggatggcgcgcgaa
gatcgcgagtacgcccagcgccgcgccgaatccagacgcggctgggaacaggactggatc
gagtgggaacggtcggtcgactcgtaa

DBGET integrated database retrieval system