KEGG   Natrialba magadii: Nmag_2478Help
Entry
Nmag_2478         CDS       T01176                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nmg  Natrialba magadii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nmag_2478
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Nmag_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2538365..2539444
Genome map
AA seq 359 aa AA seqDB search
MSLTDDTVPFDIDLLTELTETSGVPGYEDRIRDLVVAELESSVDEVRTDAMGNVVGTLEG
DSDYSVAVAAHMDEIGFMVRHVRGKEGEDGFVELDPLGGWDARVLKAQRVTIHTDDGDLP
GVIGSPPPHTLDEEDRKKTPEVEDTYVDVGLSYEDANERISPGDLVTMDQSTELVGETVT
GKALDDRICLFAMLEAARRLETPDVTIHFCATVQEEVGLRGANALGVDVDPDLAIALDVT
VANDVPGFEDGEHVTKLGEGTAIKLKDSSVITNPKVHRRLQSVADEEGIESQLEILPAGG
TDTAGFQNTAGAKPVGAISIPTRYLHTVTETAHVEDVASTIDLLEAFLASEDGEHDYTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaccgacgataccgtgccgttcgatatcgaccttttgacagaactcaccgag
accagcggtgttcctggatacgaagaccgcatccgcgacctggtcgtcgcagaactcgag
tccagtgtcgacgaggtccggaccgacgcgatggggaacgtcgtcgggacactcgagggc
gactccgactactccgttgccgtcgctgcacacatggacgaaatcggctttatggttcgc
cacgtccgcgggaaggaaggcgaggacggcttcgtcgaactcgatccgctcggcggctgg
gacgcacgtgttctcaaggcccagcgtgttacgatccacaccgacgacggcgacctaccg
ggcgtcatcggttcgccgccgccacacacactggacgaggaagaccgcaagaagacgccg
gaggtcgaggacacctacgtcgatgtcggtctttcctacgaggatgccaacgagcgcatc
tcacccggcgacctcgtgacgatggaccagtcgaccgaactcgtcggcgaaacggtcacc
ggcaaggcactcgacgaccgcatctgcctgttcgcgatgctcgaagccgcccgccgactc
gagacccccgacgtgacgatccacttctgtgcgaccgtccaggaggaagtcggcctgcgc
ggggcaaacgcactcggcgtcgacgtcgatcccgacctcgctatcgccctcgacgtcacc
gtcgcgaacgacgtacccggcttcgaggacggagagcacgtcaccaaactcggggagggg
accgcgattaaactcaaggactcgagtgtcatcacgaatccgaaggtccaccgtcgactc
cagtcggtcgccgacgaggagggaatcgagtctcaactcgagatccttccggcaggcggc
accgacacggctgggttccagaatacggcaggtgcgaagccggtgggtgcgatttcgatt
ccgacgcgatacctgcatacggtgacggagacggcccacgtcgaggacgtggcgtcgacg
atcgatctgctcgaggcgttcctcgcgagcgaggacggcgagcacgactacacgttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system