KEGG   Natrialba magadii: Nmag_2478Help
Entry
Nmag_2478         CDS       T01176                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2538365..2539444
Genome map
AA seq 359 aa AA seqDB search
MSLTDDTVPFDIDLLTELTETSGVPGYEDRIRDLVVAELESSVDEVRTDAMGNVVGTLEG
DSDYSVAVAAHMDEIGFMVRHVRGKEGEDGFVELDPLGGWDARVLKAQRVTIHTDDGDLP
GVIGSPPPHTLDEEDRKKTPEVEDTYVDVGLSYEDANERISPGDLVTMDQSTELVGETVT
GKALDDRICLFAMLEAARRLETPDVTIHFCATVQEEVGLRGANALGVDVDPDLAIALDVT
VANDVPGFEDGEHVTKLGEGTAIKLKDSSVITNPKVHRRLQSVADEEGIESQLEILPAGG
TDTAGFQNTAGAKPVGAISIPTRYLHTVTETAHVEDVASTIDLLEAFLASEDGEHDYTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaccgacgataccgtgccgttcgatatcgaccttttgacagaactcaccgag
accagcggtgttcctggatacgaagaccgcatccgcgacctggtcgtcgcagaactcgag
tccagtgtcgacgaggtccggaccgacgcgatggggaacgtcgtcgggacactcgagggc
gactccgactactccgttgccgtcgctgcacacatggacgaaatcggctttatggttcgc
cacgtccgcgggaaggaaggcgaggacggcttcgtcgaactcgatccgctcggcggctgg
gacgcacgtgttctcaaggcccagcgtgttacgatccacaccgacgacggcgacctaccg
ggcgtcatcggttcgccgccgccacacacactggacgaggaagaccgcaagaagacgccg
gaggtcgaggacacctacgtcgatgtcggtctttcctacgaggatgccaacgagcgcatc
tcacccggcgacctcgtgacgatggaccagtcgaccgaactcgtcggcgaaacggtcacc
ggcaaggcactcgacgaccgcatctgcctgttcgcgatgctcgaagccgcccgccgactc
gagacccccgacgtgacgatccacttctgtgcgaccgtccaggaggaagtcggcctgcgc
ggggcaaacgcactcggcgtcgacgtcgatcccgacctcgctatcgccctcgacgtcacc
gtcgcgaacgacgtacccggcttcgaggacggagagcacgtcaccaaactcggggagggg
accgcgattaaactcaaggactcgagtgtcatcacgaatccgaaggtccaccgtcgactc
cagtcggtcgccgacgaggagggaatcgagtctcaactcgagatccttccggcaggcggc
accgacacggctgggttccagaatacggcaggtgcgaagccggtgggtgcgatttcgatt
ccgacgcgatacctgcatacggtgacggagacggcccacgtcgaggacgtggcgtcgacg
atcgatctgctcgaggcgttcctcgcgagcgaggacggcgagcacgactacacgttgtag

DBGET integrated database retrieval system