KEGG   Natrialba magadii: Nmag_2511Help
Entry
Nmag_2511         CDS       T01176                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_2511
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_2511
   00052 Galactose metabolism
    Nmag_2511
   00500 Starch and sucrose metabolism
    Nmag_2511
   00520 Amino sugar and nucleotide sugar metabolism
    Nmag_2511
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmag_2511
   00524 Butirosin and neomycin biosynthesis
    Nmag_2511
Enzymes [BR:nmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nmag_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2573187..2574164
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAAIATDDGTTIGVSRNATPRGPTGIDVTEGVLRTLREACGDAGVT
PEAVAAAGIGSIGPFDLAEGAVIDPANLPDSIERIPLTGPIKKLLETDEVHLHNDTTAGV
IGERFHAERNPDDMVYITISSGVGAGVCCDGDILSGWDGNAGEVGHCIVDPHGRLTCGCG
HDGHWEAYCSGNGIPNFARLLADDDPTISTDLPLESPDFTAKDVFEFAGEDELADYVIEQ
LAHWNAIGVTNVVQSFAPIVVSFGGAVALHNEELVVDPIRERVSEMLLNNVPEIRVTDHG
DDVVLEGAVASALTKGTGDRQYLDA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactatgcgggcgtcgatctcggcgcgacgaacgtccgggccgcgatcgccacg
gacgacgggacgacgatcggcgtcagtcgaaacgccacgccacgcggaccaacgggaatc
gacgtaacagagggcgtcctccggacgctgcgtgaagcctgcggcgacgccggcgtcaca
ccggaagccgtcgccgctgccggcatcggctcgatcgggccgttcgacctcgcggagggg
gctgtcatcgacccggcgaacctgccggactcgatcgaacgcattccactcaccggtccg
atcaaaaagctcctcgagacggacgaggtacacctccacaacgacactactgctggtgtc
atcggcgagcgcttccacgcggagcgaaaccccgacgacatggtctacatcacgatctcc
tcgggggtcggtgccggcgtctgctgtgacggtgacatcctcagcggctgggacggtaac
gccggcgaggtcggtcactgtatcgtcgatccccacggccgcctgacctgtggctgtggc
cacgacggtcactgggaggcttactgctcgggcaacggtatcccgaacttcgcgagactt
cttgctgacgacgacccgacgatttcgactgatctgccactcgagagccctgacttcacc
gcgaaggacgtcttcgagtttgccggcgaggacgaactcgccgactacgtcatcgaacag
ctcgcccactggaacgcgatcggggtaacgaacgtcgtccagtcgttcgcgccgatcgtc
gtctcgttcggcggtgccgttgcgctgcacaacgaggaactcgtcgtcgacccgattcgc
gagcgcgtttccgagatgctgctcaacaacgtgcccgaaattcgcgtcaccgaccacggc
gacgacgtggtactcgagggcgcggttgcgagtgcgctgacgaaggggaccggcgaccgg
cagtatctcgacgcctga

DBGET integrated database retrieval system