KEGG   Natrialba magadii: Nmag_2554Help
Entry
Nmag_2554         CDS       T01176                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmg  Natrialba magadii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmag_2554
Enzymes [BR:nmg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Nmag_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2624277..2626799)
Genome map
AA seq 840 aa AA seqDB search
MEYHEAADVLFGLRRFRPKPGTASTAQLLATLDDPHEDVAFVQVAGSNGKGSTARMVEQT
LRETGLSVGLYTSPHLEDLRERVQVDGRKIPRSAVCAYVESVHDYLTEQAADGNSPTFFE
AMTAMAIWQFGRENVDVAVLEVGIGGRYDATSVVDPVASAVTSVTLEHTGILGETEAEIA
RDKAHVAPADAPLVTGVTGPVLESIREVAGEVVTVGTRGGGQGADGDDETTAPDVRVEYG
GRANHTEAAVSIDADDWSVSTQIPLPGTHQAENAGIAAALARQIADVSTDELARGLRNAH
WPGRFEVLDTEPLVVLDGAHNPGACEQLAATLGTYEFDDLHLVFGAMHDKDHREMVAALP
TPDAVITAEPGLDRAEDRDVLATVFDDAGTAQVKTTRSVPDALSQALADAGPDDCVLVTG
SLFAVAEARSRWTTTGITKRIRDRSDARNALESAQVSDADVDRFDGEAVHRVVKTNLQSS
QANRLRTELVRLGGECVVSGAEDGHEERVDAVLMGTLAQFEQLVSTLDREDGLETVAREI
GETLGLESAATAAPESDTATATPTSAETPPWADRTAVMGILNVTPDSFHDGGEFDALEDA
VERAEAMVAADVDVIDIGGESTRPGAEPVPVEEEIERVVPVIERIADLDVAISIDTRKAV
VAEAALEAGADIINDVSGLEDPEMRFVAAEHDAGLIVMHSIDSIVDPDREVTYDDVVEDV
IDQLSDRLLLAEKAGVDREQIVVDPGIGFGKSAAESFEILDRLEEFCALGYPVLVGHSHK
SMFAHVGQGPDERRDATVAASALAADRGADLIRVHDVPENVAAVRTALAARDPERFDWES
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcacgaggcggcggacgttctcttcggcttgcggcgctttcggccgaagccg
gggacggcgtcgacggcgcagctacttgcaaccctcgacgatccacacgaggacgtcgcg
ttcgtgcaggtcgccggctcgaacgggaagggcagtacggcgcggatggtcgaacagacg
cttcgcgagacggggctctcggtcggactctacacctctccccacctggaggacctccgc
gagcgtgtccaggtcgacggccggaagattccccgctcagctgtctgtgcgtacgtcgaa
tcggtccacgactacctgaccgagcaggccgccgacgggaactcgccgacgttcttcgag
gcgatgaccgcgatggcgatctggcagttcggccgcgaaaacgtcgacgtggccgtcctc
gaggtcggtatcggcggccggtacgacgcgaccagcgtcgtcgatcccgttgcgagcgcg
gttacgagcgtgacgctcgaacataccggcattctgggcgagacggaagccgaaatcgcc
cgcgacaaggcacacgtcgcacccgcggacgcaccgctcgttacaggcgtcaccgggccg
gtactcgagtccattcgggaggttgcaggcgaggtcgttacagttggaacgaggggtggg
gggcagggagcggacggtgacgacgagacgactgcgccagacgtccgcgtcgagtacggc
gggcgcgcaaaccacaccgaagccgcggtctcgatcgacgccgacgactggtccgtctcg
acgcagattccgctgccgggcactcatcaggccgagaacgccggcatcgccgccgcactc
gcacgccagatcgccgacgtgtcgaccgacgaactcgcacgcgggctgcgaaacgcccac
tggccgggacgcttcgaggtgctggataccgagccgctcgtcgtcctcgacggcgcgcac
aaccccggtgcctgcgaacaactcgctgccacgctcggaacgtacgagttcgacgacctc
cacctcgtcttcggtgcgatgcacgacaaggaccaccgcgagatggtcgccgcgctgccg
acccccgacgctgtaattacggcagagccgggactcgaccgcgccgaggaccgcgacgtg
ctcgcgactgtcttcgatgacgccggcacagcccaggtaaagacgacgcggagcgtcccc
gacgcgctctcgcaggcgctcgccgacgccggtcccgacgactgcgtcctcgtcacgggc
tcgctgttcgccgtcgccgaggcccgctcgcgctggacgacgaccgggatcaccaagcga
atccgcgaccggtcggacgcacggaatgcactcgagtccgcacaggtttcagacgccgac
gtcgaccgcttcgacggcgaagcggtccaccgcgtagtcaagacgaacctgcagtcgtcg
caggcgaaccgactgcgaacggaactggtgcgtctcggcggcgagtgtgtcgtgtcggga
gccgaggacggacacgaggagcgcgtcgatgcggtgttgatgggaacgctcgcgcagttc
gagcaactggtatcgaccctcgatcgcgaggacggactcgagacggttgcgcgtgagatt
ggcgagacgctcggtctcgagtcggcagccactgcggctccggagtcagacaccgctaca
gccacacccaccagcgccgagacaccgccctgggccgaccgcaccgccgtcatgggtatc
cttaacgtcacccccgacagcttccacgacggcggcgagttcgacgcactcgaggacgcc
gtcgagcgcgcagaggcgatggtcgcggccgacgtggacgtgatcgacatcggcggggag
tcaacccgccccggtgcagagccggtgccggtcgaggaagaaatcgagcgcgtcgtcccc
gttatcgagcggatcgcggacctcgatgttgctatctcgatcgatacgcgaaaggcggtc
gtcgccgaggccgcactcgaggccggcgcggacatcatcaacgatgtctccgggctcgag
gatcccgaaatgcgcttcgtcgcggccgagcacgacgcggggctgatcgtgatgcacagt
atcgattcgatcgtcgacccggaccgcgaggtgacctacgacgacgtcgtcgaggacgtg
atcgatcagctgtcagatcggctgttgcttgccgagaaggcaggcgtcgaccgggagcag
atcgtcgtcgatcccggaattggcttcgggaagtcggcggcggagtcgttcgagattctg
gaccgactcgaggagttctgcgcgctcggctatccggtgctcgtcggtcactcgcacaag
tcgatgttcgcccacgtcggccaggggccggacgagcggcgtgacgcgacggttgcggcg
agtgcgctcgcggcggatcggggtgcggatctcatccgggtccacgacgtgccggagaac
gtcgcggcggtccggacggcgcttgcagcgcgggatccggagcggttcgactgggaatca
tag

DBGET integrated database retrieval system