KEGG   Natrialba magadii: Nmag_2583Help
Entry
Nmag_2583         CDS       T01176                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_2583
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_2583
   00620 Pyruvate metabolism
    Nmag_2583
   00640 Propanoate metabolism
    Nmag_2583
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmag_2583
   00680 Methane metabolism
    Nmag_2583
Enzymes [BR:nmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nmag_2583
Lipid biosynthesis proteins [BR:nmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nmag_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2654878..2656902)
Genome map
AA seq 674 aa AA seqDB search
MTANTSLDDVDEIVHEPSQEFVDETNVAEFMQTYGIGGYEELIERTTTDIAGEPDSGVDW
FWDEIVDYLDIEFYEDYETVRDDGDGPQFTDWYPGGELNVAHNVVDRHAAVDEERRNKVA
TIWEGEDGNVREVTYHELRRQSNQVANALEQRGIETGDTVGLYMPMVPEVVSILYGCFKV
GAIAVPIFSGFGVDAAATRIADSECSVLFTGDGFYRRGDPVYLKGAADDAIEEAGYVEDT
IVFDRLGASDDTSEHEIPWDDVRDQWWADAVDPQSDDYETKSVPSGQESMLLYSSGTTGK
PKGIVHTHAGVQVQCAKEVYFGMDLKPSDRFFWVSDIGWMMGPWTLIGTHTFGGTVFMYE
GAPDHPEPDRFWEMIDRHKLTQFGISPTAIRALRKHGDEWLEGHDLSSLRILGSTGEPWD
PESWRWFYEHVGGGDCPIINISGGTEICGCFLMPMPTESLKPCTLGGPGIGMDIDIVDSS
GESVKDDHERGFLVARDSCPSMTKSLWSGDERYLNEYWSTFEEPPMWDHGDWAQQDEDGF
WFLHGRADDALNVAGRKVGPAEVEGALIDHDAVNQAAAIGAPDDTTGTAVVTYVILEDSV
DETDDLREALRGQVGEELGKPFRPREILFVDEFPKTQSGKIIRRAIEATYTGEDLGDMSS
IENPAALEELEDAR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaacacgagtctcgacgacgtcgacgaaatcgtccacgaacccagccaggag
ttcgtcgacgagacgaacgtcgccgagttcatgcagacctacgggatcggtgggtacgag
gagctaatcgaacgaacgacgaccgatattgcgggagagccagacagcggcgtcgactgg
ttctgggacgagatcgtcgactacctggatatcgagttctacgaagactacgagacggtc
cgagatgacggcgatggaccgcagttcaccgactggtaccccggcggcgaactcaacgtg
gcacacaacgtggtcgatcgccacgccgctgtcgacgaagagcgccgaaacaaggtcgcc
accatctgggaaggcgaggacggcaacgtgcgggaggttacgtaccacgaactccgccgg
cagtcgaaccaggtcgcgaacgccctggaacagcgcggcatcgagaccggcgatacggtc
gggctctacatgccgatggtgccggaggtcgtctcgatcctctatggctgtttcaaggtc
ggcgcgatcgcggtcccgatcttctcgggcttcggcgtcgacgctgcggcgacgcgcatt
gcggattcggagtgctccgtcctcttcacgggtgacggcttctaccgccgcggcgatccg
gtttacctcaagggcgcagcagacgatgccatcgaggaggcgggctacgtcgaggacacc
atcgtcttcgaccgcctcggtgcgagcgacgacaccagcgaacacgagattccgtgggac
gacgtccgcgaccagtggtgggccgacgccgtcgatccgcagtccgacgactacgagacg
aaatcggttccctcgggtcaggagtctatgctgctgtactcctctggcaccaccggcaag
ccgaaggggatcgtccacacccacgccggtgtgcaggtccagtgtgccaaggaggtctac
ttcggaatggacctgaagccgtccgaccggttcttctgggtttcggacatcggctggatg
atggggccgtggaccctcatcgggacccacaccttcggcggtactgtcttcatgtacgag
ggcgcgccggaccaccccgaaccggaccgcttctgggagatgatcgaccgccacaaactc
acccagttcggtatctctccgaccgcaattcgcgccctgcgaaagcacggggacgagtgg
ctcgagggtcacgacctctcctcgctgcgcatcctcggttcgaccggcgaaccctgggac
cccgaatcctggcgctggttctacgagcacgtcggcggcggcgactgtccgatcatcaac
atctccggcggcaccgaaatctgtggctgcttcctgatgccgatgccgaccgaatccctc
aagccctgcacgctcggcgggccggggatcgggatggatatcgacatcgtcgactcgtcg
ggcgagtccgtcaaagatgatcacgaacgcggcttcctcgtcgcccgcgactcctgtccc
tccatgaccaagtcgctctggtcgggcgacgaacgctacctgaacgaatactggtcgacg
ttcgaggagccgccgatgtgggaccacggcgactgggcccagcaagacgaggacggcttc
tggttcctccacggccgcgccgacgacgcgctgaacgtcgccggccggaaggtcggcccc
gccgaagtcgagggcgcgctcatcgaccacgacgcggtcaaccaggccgccgccatcggc
gcgccggacgacaccaccggcaccgcggtcgtcacctacgtcatcctcgaggacagcgtc
gacgaaaccgacgacctccgcgaagcgcttcgggggcaggtcggcgaggaactcggcaag
ccgttccgtccccgggaaatcctgttcgtcgacgaattcccgaaaacgcaatcaggcaag
atcattcgccgcgctatcgaggcaacctacaccggtgaagacctcggtgacatgagcagc
atcgagaacccggccgcactcgaggaactcgaggacgcacggtag

DBGET integrated database retrieval system