KEGG   Natrialba magadii: Nmag_2584Help
Entry
Nmag_2584         CDS       T01176                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nmg  Natrialba magadii
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Nmag_2584
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Nmag_2584
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Nmag_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2656917..2657774)
Genome map
AA seq 285 aa AA seqDB search
MSQQQVAPPSVTRSDIHTIDDDSFTARNVCLVTGAGSGIGRATALAAAGNGLTVAATDID
EDALAETVARRNELDLQGEIEQIVGDLTVDDDIEQIVETAASHGDIKYLANVAGMQHIDA
IENFPMDAYDRMHRVMVRAPLYLSKLCLPHFRDTASGDGCVGNMASVHGHYVTSDKVGYN
ISKFGLRGLTQSIAAEGAGDVRSFSISTGYVQTPLVMDQLEDTAEQRGISVDEVIQDVML
GQSRVTEMMAPIDVGNLFVLGFSELGRHLDGGDLLFDGGMTLTYE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcaacaggtcgcgccaccgtcggtaacgcgctcggatatccatacgatcgac
gacgactcgttcactgcacggaacgtctgtctcgttaccggagcgggctctgggatcggt
cgtgcaaccgcactcgccgccgccggaaacgggttgaccgtcgcggcgacagatatcgac
gaggacgcactcgcggaaacggtcgcccgacgcaacgaactcgatctgcagggtgaaatc
gagcaaatcgtcggtgacctcacggtcgacgacgacatcgaacaaatcgtcgagacggcc
gcaagccacggtgacatcaagtacctcgcgaacgtcgccggaatgcaacacattgatgcg
atcgaaaacttcccgatggatgcctacgatcgcatgcatcgggtgatggttcgagcaccg
ctgtatctctcgaaactgtgtcttcctcacttccgtgacactgcgagcggtgatggctgt
gtggggaacatggcatcggtccacggccactacgtcacgagcgacaaggtcgggtacaac
atctcgaaattcgggctacgcggcctcacacagtcgatagcggctgaaggtgcaggcgac
gttcgctcgttctcgatcagcaccgggtacgtccagacgccgctcgtgatggaccaactc
gaggacacggccgagcagcggggcatctcggtcgacgaggtgattcaggacgtgatgctc
ggccagtcccgcgtcacagagatgatggcgccaatcgacgtcggcaatctctttgtgctc
ggcttttccgaactgggccggcatctggacggcggcgacctgttgtttgatgggggcatg
acgctaacgtacgagtga

DBGET integrated database retrieval system