KEGG   Natrialba magadii: Nmag_2661Help
Entry
Nmag_2661         CDS       T01176                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nmg  Natrialba magadii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmg01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nmg00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2742183..2744111
Genome map
AA seq 642 aa AA seqDB search
MTELGGFQDRLARIDLSDGSVGYESIDEEDARKYIGARGLGVKHVFEQGPDVDPLGPDNL
LAFMNGPLSGTQVTMSGRIAVCTKSPLTGTVTDSHHGGWSGARLKWAGFDGLLVEGEADD
PVYAYVEDGEVELRDASHLWGLGVHETRDQLEEEVDGSYGKNLSLMAIGPGGENEVKYAC
IMNEDDRASGRGGTGCVMGSKNLKAIVIKSTTKMPQPADQETFREGHQQAMQAITESEVT
APNEGGLSMYGTNVLMNIGEEMDGLPTKNGRYTSTEAMRDAEGVDIDAERVSGENVRENI
LVDEPTCHSCPVACKKEVEVQAMHKGEEMNVRTESYEYESAYALGPNSGHTDRDAVALML
ERCNDMGVDTIETGNMMAMAMEMSEEGKLTDEGELEWGDTETMIDMIERIAHREDDLADL
LAEGPRRVADRKEAHDNSLAVKGQTIAAYDPRCMKGMGIGYATSNRGACHLRGYTPAAEI
LGIPEKVDPYEYEGKGELTAAFQDLHAISDSFDICKFNAFAEGIEEYVLQYNGMTGLDVS
EEELLEAGERIYNLERYYNNLVGFDGADDSLPARFLEGEDGIPGQGASEGEFCELDEMKE
EYYDHRGWVDGVVPDEKLEALEIDIGPGTGVSAGDSPAPADD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcggcggttttcaggaccggctcgcacgcatcgatctgtccgacggctcg
gtcggctacgagtcgattgacgaggaagacgcacggaagtatatcggtgcacgcggactg
ggtgtaaagcacgtgttcgaacaggggccggacgtcgatccgctcggaccggacaacctg
ctcgcgttcatgaacggaccactctcggggacacaggtgacgatgagcggccggatcgcc
gtctgtacgaagtcaccactgaccggcaccgtcaccgacagccatcacggcggctggtcc
ggcgcgcgcctgaagtgggccggcttcgacggcctactggtcgaaggcgaggccgacgac
cccgtctacgcctacgtcgaagacggcgaggtcgaactccgcgacgccagccacctctgg
gggctgggcgtccacgagacccgcgaccaactcgaggaggaggtcgacggcagctatgga
aagaacctctcgctgatggccatcggccctggtggcgagaacgaggtcaagtacgcctgt
atcatgaacgaggacgaccgtgcctcgggccgcggcggcacgggctgtgtcatggggtcg
aagaacctcaaggcgatcgtcatcaagtcgacgacgaagatgccccagccggccgatcag
gagacgttccgcgagggccaccagcaggcgatgcaggcgatcacggaatccgaagtcacc
gcgccgaacgagggcggcctctcgatgtacgggacgaacgtcctgatgaacatcggcgag
gagatggacggtctgccgacgaaaaacggccgctacacctcgactgaggctatgcgcgac
gcggaaggcgtcgacatcgacgcagaacgcgtctccggagagaacgtccgcgagaacatt
ctcgtcgacgaaccgacctgccactcctgtccggtcgcctgcaagaaggaagtcgaagtc
caggcgatgcacaagggcgaggagatgaacgtccgcaccgaatcctacgagtacgaatcc
gcctacgcgctcggtccgaactccggccacaccgaccgcgacgccgtcgcgctcatgctc
gagcgctgtaacgacatgggcgtcgataccatcgagacgggcaacatgatggcgatggcc
atggagatgtccgaggagggcaaactcactgacgagggtgaactcgagtggggcgacacg
gagaccatgatcgacatgatcgagcggatcgcccaccgcgaggatgacctcgcggacctg
ctcgcggaggggccacgccgcgtcgcggatcgcaaggaggctcacgacaactccctcgcg
gtgaagggccagacgatcgcggcctacgacccgcgctgcatgaaaggaatgggcattggc
tacgccacctcgaaccggggggcctgtcacctgcgcggatacacgcccgccgcagagatt
ctgggcattccggagaaggtcgacccctacgagtacgaggggaagggcgaactcaccgcc
gccttccaggatctgcacgccatcagcgattcgttcgacatctgcaagttcaacgccttc
gcggagggaatcgaagagtacgtcctccagtacaacggcatgacgggcctcgacgttagc
gaggaggaactgctcgaagctggcgaacgcatctacaacttggagcgctactacaacaac
ctcgtcggcttcgacggcgctgacgactcgctcccggcgcgcttcctcgagggcgaggac
ggcatccccgggcagggcgcgagcgagggcgagttctgcgaactcgacgagatgaaagaa
gagtactacgaccaccgcggctgggtcgacggcgtcgtccccgacgagaaactcgaagcc
ctcgagatcgatattgggccggggacgggtgtctctgcgggcgattcgccggcaccggca
gacgactga

DBGET integrated database retrieval system