KEGG   Natrialba magadii: Nmag_2816Help
Entry
Nmag_2816         CDS       T01176                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmg  Natrialba magadii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmag_2816
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_2816
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmag_2816
Enzymes [BR:nmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nmag_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2890096..2890986)
Genome map
AA seq 296 aa AA seqDB search
MSGEQTAAIDSDIEAAIREDHPALITYITAGDPSLEDTKEYVEALDRGGSDLIELGLPFS
EPIAEGPTIQAAINRALDAGTTPARFFELVDELETDAPLLVMTYYNMILQYGSEPDVRPF
VERAADAGLSGIIVPDLPAEEADPLRDACDDYGLDLVFIVAPTTAGERLDRIMSQVSGFA
YVQARLGTTGARADVSNATHDSLTRLSEYDVPKAVGFGVSEGDHAAEIIEAGADGVIVGS
ALVDIIAEHGTGDAPAADALESKARELKRGARRGGEQGQRNGHERRREEAPEPEQP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaacagacagcggcgatagacagcgacattgaggccgccatccgcgaggac
caccccgcgctcattacgtacatcacggcgggtgacccctcgctcgaggacaccaaggaa
tacgtcgaggcccttgaccgcggcgggtcggacctgatcgaactcggactgccgttttcc
gaaccgatcgccgagggcccgaccatccaggccgcgatcaaccgcgcgctcgacgccggg
acgacgcccgcgcggttcttcgaactcgtggacgaactcgagacggacgcgccgctgctg
gtgatgacgtactacaacatgatcctccagtacggctctgaacccgatgtccgtccgttc
gtggagcgagcagccgacgcgggcctctcggggatcatcgttcccgacctccccgcggag
gaggcggacccgctccgtgacgcctgcgacgactacggcctcgatctcgtcttcatcgtc
gcgccgacgaccgccggcgagcgcctggaccgaatcatgtcccaggtctcgggcttcgcc
tacgttcaggcccgactcgggacgaccggcgcgcgagcggatgtctcgaacgcgacccac
gacagcctgactcggctctccgagtacgatgtccccaaggccgtcggcttcggcgtcagc
gagggcgaccacgccgccgaaatcatcgaggccggcgcggacggagtcatcgtcggcagc
gcgctcgtcgacatcatcgccgagcacggcaccggcgacgcgcccgcggcggatgcactc
gagtccaaggcgcgcgaactcaagcggggggcgcgccgcggcggcgagcagggacagcgg
aacggacacgagcggcggcgggaagaagcaccggaaccagaacagccataa

DBGET integrated database retrieval system