KEGG   Natrialba magadii: Nmag_2818Help
Entry
Nmag_2818         CDS       T01176                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmg  Natrialba magadii
Pathway
nmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01130  Biosynthesis of antibiotics
nmg01230  Biosynthesis of amino acids
Module
nmg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmag_2818
Enzymes [BR:nmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nmag_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth FMN_dh AP_endonuc_2 Trp_syntA ThiG
Motif
Other DBs
NCBI-ProteinID: ADD06372
UniProt: D3SZW2
Position
complement(2892251..2893120)
Genome map
AA seq 289 aa AA seqDB search
MTSGTELAPPVQSILAAATERAGEVRTQGRAPLDVDARSFPDAAARTEHDGRVPVIAEVK
PTSPTTDGTREDDPAELAEAMVAGGATAISVLTEPTHFGGSPDALRQVREAVDVPVLRKD
FILEEASLDVVESDLILLIARFVDNLADLVAAARERGFQPLVEVHDREELADALDAGATL
IGVNNRDLAQLEVDLGTFESVAPHAKRLCRLDESSGGTARQDPDDVTLIAESGISTPADV
RRMRDAGADALLVGSAIMDHGADGDVTANTRRLVEAAEPTATTETRTQT
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacttctggtacggagctcgcaccaccggtgcaatccattctcgcagccgccaccgag
cgcgctggggaggtgcgcacccagggacgagcaccgctcgatgtcgatgcgcggtcgttt
cccgacgcggccgcgcggactgaacacgacggccgggtaccggtcatcgcagaggtgaaa
ccgacgagtccgacgacggacggcacgcgcgaggacgaccctgccgaactggccgaagcg
atggttgcaggcggtgcaacggcaatctcagtattgactgaaccaacccacttcggcggc
tcgccggacgccctgcggcaggttcgagaggccgtcgacgtccccgtcctccggaaggac
ttcatcctcgaggaggcgagtctggacgtggtcgaatccgatctgatcctcttgattgcc
cgattcgtcgacaatctcgctgacctcgtggcggccgctcgtgagcgcggcttccagccc
ctcgtcgaggttcacgaccgcgaggaactcgctgacgcactcgacgccggcgcgacgctc
atcggagtgaacaaccgagatctcgcgcaactcgaggtcgatctggggacgttcgaatcg
gtcgcaccgcacgcgaagcgactctgtcgcctcgatgagtcgagcggtggaaccgcgaga
caggacccggacgatgtcacgctgatcgccgaaagcgggatttctactcctgcggacgtc
cgtcggatgcgcgacgcgggcgcggacgcgttactggtcggaagcgccatcatggaccac
ggcgctgacggcgatgtgacggccaacacgcgacgactggtggaggcagcagaaccgaca
gcaacgacggagacacgcacacagacatga

DBGET integrated database retrieval system