KEGG   Natrialba magadii: Nmag_2964Help
Entry
Nmag_2964         CDS       T01176                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nmg  Natrialba magadii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nmag_2964
Enzymes [BR:nmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Nmag_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3051396..3052367)
Genome map
AA seq 323 aa AA seqDB search
MVRVLTAGHVNWDVTLRVDRLPEADCESAIRSQHRSGGGSAANVAAALANLSLDTGLIGS
VGDDDNGLLASRELESAGVSLDGLRVVEGADTAVKYLLVDDEGEVAVLGNDGVNEAVTPA
DLDRDRIRSADHVHLTSQRPETAGAIAQTANEAGVGVSFDPGRRLCDRDYTDALAVADIV
FANDQEIASLLEDEYVGSAFDDRIVVVKYGGDGAEVHTPGGSYVHPGFDVDTVDTAGAGD
AFAAGFIATLLEQHEGESLASDAASVSSASSVPSVPSIPSVSGVDIEQALEFANACGALT
ASEKGARSAPTLSRVTAFLKTRF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtcagggtgctcactgccggtcacgtcaactgggacgtgaccctccgtgtcgatcgg
ctccccgaagctgactgtgagtctgcaatccgctcacagcaccgttccggcggcggcagc
gctgcgaacgtcgccgccgcactcgcgaatctctccctcgataccggtctcatcggcagc
gtcggcgacgacgacaatggcctgctcgccagccgggaactcgagtccgccggcgtctcg
ctcgacgggctccgggtcgtcgagggtgcagacaccgcggttaaatatctgctcgtcgac
gacgagggcgaggtcgccgtcctcgggaacgacggcgtcaacgaggccgttacacccgcg
gatctcgaccgtgatcgaattcgcagcgcggatcacgtccacctcacgagtcagcgacct
gagaccgccggtgcgatcgcacagacggcgaacgaagccggcgtcggtgtcagtttcgat
ccgggacggcgactctgcgaccgcgactacaccgacgcactcgccgtggccgacatcgtc
ttcgcgaacgaccaggaaatcgccagccttctcgaggacgagtacgtcggctcggcgttc
gacgaccggatcgtcgtcgtgaagtacggcggcgatggtgccgaagtgcacacgcccggt
ggctcctacgtccatcccgggttcgatgtcgacaccgtcgacacggctggcgctggtgac
gcctttgccgcggggttcattgcgacgctcctcgagcaacacgagggcgagtcgctcgct
tctgacgctgcgtcggtgtcgtcggcgtcatcggtgccgtcggtgccgtcgataccctcg
gtctcaggcgtcgatatcgaacaggcactcgagttcgcaaacgcctgtggtgcgctgacg
gcgagtgaaaaaggcgcacgaagtgcaccgacgctgtcacgagtgaccgcctttctcaaa
acgagattctaa

DBGET integrated database retrieval system