KEGG   Natrialba magadii: Nmag_3049Help
Entry
Nmag_3049         CDS       T01176                                 

Definition
glucosamine/fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
nmg  Natrialba magadii
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmg00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nmg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148502..3150316)
Genome map
AA seq 604 aa AA seqDB search
MCGIIGHVGTDDALDTLLTGLENLEYRGYDSAGIAVQNGSGIAVQKRSGKVEELKSSIGE
RHIEGNVGIGHTRWSTHGPPTDENAHPHTDGTEDVAVVHNGIIENYAGLKTWLRERGHTF
TSDTDTEVIPHLIQYYLDEGMESEAAFRRAIDELEGSYAVTAMVDGEHVLYAARKGSPLV
VGVEDDEFFLASDVPAFLEYTDTVAYLEDGDVAIIDVEGVEFTDLAGESISRELETVEWD
PEQAGKGEYDHFMLKEIHEQPTALAQAIEGRIDPENGRIALEDFPPGTFDGVENVQLIAC
GTSYHAALYGSVALNQAGIHATALLANEYSVTAPPVDDDTLVIAVTQSGETADTLSALRQ
ATAAGADTLTVTNVVGSTAAREADDTLFIRAGPEIGVAATKTFSSQAVMLTLLAQRIAAD
ARDETPADLQSLLPDLAQMPGQLEDLLATDDAAHIASQYQGSQSYFFIGRGLGYPVALEG
ALKFKEITYEHAEGFASGELKHGPLALVTPDTPVFAVFTGEEDEKTLKNAEEAQTRGAPV
IAVCPEGHRAAEVADEHLEIPDADDELAGLLANVQLQLVSYHAAELLDRPIDKPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattatcggtcacgtcggcactgacgacgcactggatacactcctgaccggg
ctggagaatctcgagtatcgtggctacgactccgccggtatcgcggtccagaacggctcc
ggtatcgccgtccagaaacgctctgggaaggtcgaggagctaaagagttcgattggagag
cgccacatcgagggtaacgtcggcatcggtcacacgcgctggtcgactcacgggccgccg
accgacgagaacgcccatccacacaccgacggcaccgaagacgtcgccgtcgtccacaac
ggcatcatcgagaactacgctgggctcaaaacgtggctccgcgagcgtggccacacgttc
acgagcgataccgacaccgaagttatcccacacctcattcagtactacctcgacgaaggc
atggaaagcgaggccgcattccgtcgtgccatcgacgaactcgaggggagctacgccgtg
accgcgatggtcgacggcgaacacgttctctacgctgctcgcaagggctccccgctcgtc
gtcggcgtcgaggacgacgagttcttcctcgccagcgacgtgccggcgttcctcgagtac
accgacaccgtcgcctatctggaggacggtgacgtagcgattatcgacgtggagggcgtc
gagtttaccgacctcgcaggcgagtcaatctcgcgcgaactcgagaccgttgagtgggac
cccgaacaggctggcaagggcgagtacgaccacttcatgctcaaagagattcacgagcaa
ccgaccgcgctcgcccaggccatcgagggccgaatcgaccccgaaaacgggcgaatcgcg
ctcgaggatttcccgccggggacgttcgacggcgtcgagaacgtccagctcatcgcctgc
gggacgtcctatcacgctgccctgtacggctcggtcgcgctgaatcaggccggcatccac
gcgacggcgctgctcgcgaacgagtatagcgtgacggcaccgccggtcgacgacgacaca
ctcgtaatcgcggtcacccagagcggcgagacggcagacacgctgagtgcgctccggcag
gcgaccgcagcgggtgccgacacgctcacggtcacgaacgtcgttggctcgaccgccgcc
cgcgaagctgacgacacgctgttcatccgcgccggccccgagatcggcgtcgccgcaacc
aagacgttctcctcgcaagccgtcatgctcacactgctcgcccagcggatcgccgccgat
gcccgcgacgagactccggcggacctgcagtcactactccccgacctggcccagatgccg
ggccaactcgaggacctgctcgccacagacgacgctgcacacattgcgagccaataccag
ggcagccagtcgtacttcttcatcggtcgcggcctcggctatccggttgcactcgagggc
gcgctcaaattcaaggagattacctacgaacacgcagagggctttgcctcgggcgaactc
aagcacgggccgctcgcgctggtaacgccggatacgccggtgttcgcggtcttcaccggc
gaggaggacgagaagacgctgaagaacgccgaggaagcccagacacgtggtgcgccggtc
atcgcggtctgtcccgagggacaccgcgcggccgaggtcgcagacgagcatctcgagatt
cccgacgctgacgacgaactggcggggctgctcgcgaacgtgcagctccagctcgtctcc
taccacgcggcggagctgctcgatcggccgatcgacaagccgcggaacctcgccaagagc
gtcacggtcgagtag

DBGET integrated database retrieval system