KEGG   Natrialba magadii: Nmag_3049Help
Entry
Nmag_3049         CDS       T01176                                 

Definition
glucosamine/fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
nmg  Natrialba magadii
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nmag_3049
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nmag_3049
Enzymes [BR:nmg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Nmag_3049
Peptidases [BR:nmg01002]
 Cysteine Peptidases
  Family C44
   Nmag_3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148502..3150316)
Genome map
AA seq 604 aa AA seqDB search
MCGIIGHVGTDDALDTLLTGLENLEYRGYDSAGIAVQNGSGIAVQKRSGKVEELKSSIGE
RHIEGNVGIGHTRWSTHGPPTDENAHPHTDGTEDVAVVHNGIIENYAGLKTWLRERGHTF
TSDTDTEVIPHLIQYYLDEGMESEAAFRRAIDELEGSYAVTAMVDGEHVLYAARKGSPLV
VGVEDDEFFLASDVPAFLEYTDTVAYLEDGDVAIIDVEGVEFTDLAGESISRELETVEWD
PEQAGKGEYDHFMLKEIHEQPTALAQAIEGRIDPENGRIALEDFPPGTFDGVENVQLIAC
GTSYHAALYGSVALNQAGIHATALLANEYSVTAPPVDDDTLVIAVTQSGETADTLSALRQ
ATAAGADTLTVTNVVGSTAAREADDTLFIRAGPEIGVAATKTFSSQAVMLTLLAQRIAAD
ARDETPADLQSLLPDLAQMPGQLEDLLATDDAAHIASQYQGSQSYFFIGRGLGYPVALEG
ALKFKEITYEHAEGFASGELKHGPLALVTPDTPVFAVFTGEEDEKTLKNAEEAQTRGAPV
IAVCPEGHRAAEVADEHLEIPDADDELAGLLANVQLQLVSYHAAELLDRPIDKPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattatcggtcacgtcggcactgacgacgcactggatacactcctgaccggg
ctggagaatctcgagtatcgtggctacgactccgccggtatcgcggtccagaacggctcc
ggtatcgccgtccagaaacgctctgggaaggtcgaggagctaaagagttcgattggagag
cgccacatcgagggtaacgtcggcatcggtcacacgcgctggtcgactcacgggccgccg
accgacgagaacgcccatccacacaccgacggcaccgaagacgtcgccgtcgtccacaac
ggcatcatcgagaactacgctgggctcaaaacgtggctccgcgagcgtggccacacgttc
acgagcgataccgacaccgaagttatcccacacctcattcagtactacctcgacgaaggc
atggaaagcgaggccgcattccgtcgtgccatcgacgaactcgaggggagctacgccgtg
accgcgatggtcgacggcgaacacgttctctacgctgctcgcaagggctccccgctcgtc
gtcggcgtcgaggacgacgagttcttcctcgccagcgacgtgccggcgttcctcgagtac
accgacaccgtcgcctatctggaggacggtgacgtagcgattatcgacgtggagggcgtc
gagtttaccgacctcgcaggcgagtcaatctcgcgcgaactcgagaccgttgagtgggac
cccgaacaggctggcaagggcgagtacgaccacttcatgctcaaagagattcacgagcaa
ccgaccgcgctcgcccaggccatcgagggccgaatcgaccccgaaaacgggcgaatcgcg
ctcgaggatttcccgccggggacgttcgacggcgtcgagaacgtccagctcatcgcctgc
gggacgtcctatcacgctgccctgtacggctcggtcgcgctgaatcaggccggcatccac
gcgacggcgctgctcgcgaacgagtatagcgtgacggcaccgccggtcgacgacgacaca
ctcgtaatcgcggtcacccagagcggcgagacggcagacacgctgagtgcgctccggcag
gcgaccgcagcgggtgccgacacgctcacggtcacgaacgtcgttggctcgaccgccgcc
cgcgaagctgacgacacgctgttcatccgcgccggccccgagatcggcgtcgccgcaacc
aagacgttctcctcgcaagccgtcatgctcacactgctcgcccagcggatcgccgccgat
gcccgcgacgagactccggcggacctgcagtcactactccccgacctggcccagatgccg
ggccaactcgaggacctgctcgccacagacgacgctgcacacattgcgagccaataccag
ggcagccagtcgtacttcttcatcggtcgcggcctcggctatccggttgcactcgagggc
gcgctcaaattcaaggagattacctacgaacacgcagagggctttgcctcgggcgaactc
aagcacgggccgctcgcgctggtaacgccggatacgccggtgttcgcggtcttcaccggc
gaggaggacgagaagacgctgaagaacgccgaggaagcccagacacgtggtgcgccggtc
atcgcggtctgtcccgagggacaccgcgcggccgaggtcgcagacgagcatctcgagatt
cccgacgctgacgacgaactggcggggctgctcgcgaacgtgcagctccagctcgtctcc
taccacgcggcggagctgctcgatcggccgatcgacaagccgcggaacctcgccaagagc
gtcacggtcgagtag

DBGET integrated database retrieval system