KEGG   Natrialba magadii: Nmag_3126Help
Entry
Nmag_3126         CDS       T01176                                 

Definition
succinate dehydrogenase subunit D (membrane anchor protein)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmg  Natrialba magadii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_3126
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmag_3126
   00650 Butanoate metabolism
    Nmag_3126
  Energy metabolism
   00190 Oxidative phosphorylation
    Nmag_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3238317..3238682
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTAWFLQRVTAAFLIVVLAFHFFLLHFVNHASEITFAGTQARMENIGYF
LTMVLFLIAGAFHGVNGVYNALVNQGLSGTPKKVVLAVLTIAGALLIFQGIWVALVMSGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgctactcttcgttcacgcccggcgggaccgcctggttcctccagcgtgtg
acggcagcgttcctgatcgttgtgcttgctttccacttcttcctcttgcacttcgtcaac
cacgcgtccgaaatcacgttcgcggggacgcaagcccgcatggagaacattggctacttc
ctgacgatggtgttgttcctcattgctggcgcgttccacggtgtcaacggcgtctacaac
gcgctcgtcaatcagggcctcagcgggaccccaaagaaggtagtgctcgcagtgctaact
atcgcaggtgccctgctcatcttccagggaatctgggttgcactagtcatgtcgggaatg
atctaa

DBGET integrated database retrieval system