KEGG   Natrialba magadii: Nmag_3167Help
Entry
Nmag_3167         CDS       T01176                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmg  Natrialba magadii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmag_3167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_3167
   00620 Pyruvate metabolism
    Nmag_3167
   00640 Propanoate metabolism
    Nmag_3167
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmag_3167
   00680 Methane metabolism
    Nmag_3167
Enzymes [BR:nmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nmag_3167
Lipid biosynthesis proteins [BR:nmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nmag_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3280885..3282861)
Genome map
AA seq 658 aa AA seqDB search
MSQEDANLEARLEEQEAFDPPESFVEQANVTDPGIYEEFEENWPDCWERAADLISWDEEY
DTVLEDGDAPFYEWFTGGELNASYNCLDRHVEDGRADEAAIEWVGELGETRSYTYDELLA
EVNEFAATLRGLGVEEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATRM
NSADSEYLVTCDGYYRRGDALDHISKTNEGLEGVEHEVSDVVVVDRLGDDLEHSLADNQH
DYDELVADYEGETVEPVSRDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYTAWTSRAVLD
IEADDTYWCAADIGWITGHSYIVYGPLALGTTSVMYEGTPDYPEKDRLWQIVEDYGVDIF
YTAPTAIRAFMKWGKEYPEKHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEECPIVDTWW
QTETGGMMITTLPGINTMKPGSAGPPLPGIDARVVSASGEEVDAGQAGYVTVDKPWPGML
RTLYNNDERFINEYWREYSDEETDEWVYFPEDGAKIDDDSYITILGRVDDVINVSGHRLG
TMEIESAVVGVDGIAEAAVVGGDHEVKGEAVYVYAIPEDGYDADAELEERAVEGVLDSIG
PIAKPEDVVFTPELPKTRSGKIMRRLLEDIASGNELGNTSTLRNPGVVDDIAAQVEES
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaggatgccaacctcgaggcacgactcgaagagcaggaggcgttcgatccg
ccagagtcgttcgtcgagcaggcaaacgtcactgatccgggaatctacgaggagttcgag
gagaactggcccgactgttgggagcgggccgctgacctcatctcgtgggacgaggagtac
gataccgtcctcgaggacggggatgcaccgttctacgagtggttcaccggcggcgagttg
aacgcttcgtacaactgtctcgaccgccacgtcgaggacggacgggcggacgaggcggcg
atcgagtgggtcggcgaactcggggagactcgcagctacacttacgacgagttgctcgcg
gaggtaaacgagttcgcggcgacgctgcgcggactcggtgtcgaggaagacgacgtcgtc
accctctacatgccgatgattccagagctcccgatcgcgatgctcgcctgtgctcgcatc
ggcgcgccacacagtgtcgtcttcgcgggtttctccgcggacgcactcgcgacccggatg
aactcggccgacagcgagtacctggtcacctgtgacggctactaccgtcgcggtgacgca
ctcgatcacatctcgaagaccaacgagggactcgagggcgtcgagcacgaggtctccgat
gtcgtcgtcgtggaccgactgggtgacgacctcgagcactcgctggcggacaaccagcac
gactacgacgagctcgtcgccgactacgagggagagacggtcgagccggtgtcgcgagat
gccgaggatatgctgttcctgatgtacacctcgggaacgacgggtcagccgaagggcgtc
aaacacacgactggcggctacctcgcgtacacggcctggaccagccgcgccgtcctcgat
atcgaggccgacgacacctactggtgtgcggccgacatcggctggatcacgggccactcc
tacatcgtctacgggccgcttgcactcggaacgacctcggtgatgtacgaggggacgccg
gactaccccgagaaggatcgcctctggcagatcgtcgaggactacggggttgatattttc
tacacagcgccgacggccatccgcgccttcatgaagtgggggaaggagtatcccgagaaa
cacgatctctcctcgctgcgcctgctcggcaccgtcggtgagccgatcaacccgcgagcc
tggaagtggtactacaaacacatcggcaacgaggagtgtcccatcgtcgacacctggtgg
cagactgagacgggtggcatgatgatcacgacactgccgggtatcaacacgatgaaaccc
ggttctgccggcccgccgctcccgggtatcgacgcgcgtgttgtcagcgctagcggcgaa
gaggtcgacgctggacaggccggctacgtcaccgtcgacaaaccgtggccgggcatgctc
cggacgctgtacaacaacgacgagcgattcatcaacgagtattggcgcgaatactcggac
gaggagacagacgagtgggtctacttcccagaggacggggcgaaaatcgacgacgacagc
tacatcacgatcctcggccgcgtcgacgacgtgatcaacgtctccggccaccgcctcggg
acgatggagatcgaatccgccgtcgtcggcgtcgatggcatcgccgaagccgccgtcgtc
ggcggcgaccacgaggtcaagggcgaagccgtctacgtctatgccattcccgaggacggc
tacgacgctgacgccgaactcgaggagcgcgccgttgaaggcgtgctcgactcgattggt
ccgatcgcgaaacctgaagacgttgtcttcacgccagaacttcccaaaacgcggtccggc
aagattatgcgccgtctgttagaggatatcgcgagcgggaacgaactcggcaacacctcg
acgctgcgcaaccccggcgtcgtcgacgacatcgctgcacaggtcgaggagagctaa

DBGET integrated database retrieval system